BLASTX nr result
ID: Akebia23_contig00054286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054286 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003297994.1| hypothetical protein PTT_08571 [Pyrenophora ... 57 3e-06 ref|XP_001940635.1| hypothetical protein PTRG_10303 [Pyrenophora... 56 6e-06 >ref|XP_003297994.1| hypothetical protein PTT_08571 [Pyrenophora teres f. teres 0-1] gi|311329042|gb|EFQ93906.1| hypothetical protein PTT_08571 [Pyrenophora teres f. teres 0-1] Length = 294 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = -3 Query: 376 RDVDRRDRPGAPKRSGSKWQKEAQAMFMTYALPVIKKEGAKYMARQMGNLANKR 215 RD + +PG P+ WQK+A MF YALP+IKKEGAKY+ +QM N +R Sbjct: 246 RDAGKPGKPGQPE-----WQKQAMGMFKDYALPIIKKEGAKYVQKQMANGFGRR 294 >ref|XP_001940635.1| hypothetical protein PTRG_10303 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976728|gb|EDU43354.1| hypothetical protein PTRG_10303 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 281 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/54 (48%), Positives = 35/54 (64%) Frame = -3 Query: 376 RDVDRRDRPGAPKRSGSKWQKEAQAMFMTYALPVIKKEGAKYMARQMGNLANKR 215 RD + +PG P+ WQ++A MF YALP+IKKEGAKY+ +QM N +R Sbjct: 233 RDAGKPGKPGQPE-----WQRQAMGMFKDYALPIIKKEGAKYVQKQMANGFGRR 281