BLASTX nr result
ID: Akebia23_contig00053531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00053531 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015605.1| Ubiquitin-specific protease 8 isoform 3 [The... 56 5e-06 ref|XP_007015604.1| Ubiquitin carboxyl-terminal hydrolase 8 isof... 56 5e-06 ref|XP_007015603.1| Ubiquitin carboxyl-terminal hydrolase 8 isof... 56 5e-06 ref|XP_003596922.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 55 8e-06 >ref|XP_007015605.1| Ubiquitin-specific protease 8 isoform 3 [Theobroma cacao] gi|590586085|ref|XP_007015606.1| Ubiquitin-specific protease 8 isoform 3 [Theobroma cacao] gi|508785968|gb|EOY33224.1| Ubiquitin-specific protease 8 isoform 3 [Theobroma cacao] gi|508785969|gb|EOY33225.1| Ubiquitin-specific protease 8 isoform 3 [Theobroma cacao] Length = 658 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 93 PLLGQGEVASAFGDLLRKLWAPGATPVAPR 4 PL GE+ASAFGDLLRKLWAPGATPVAPR Sbjct: 100 PLGMNGEIASAFGDLLRKLWAPGATPVAPR 129 >ref|XP_007015604.1| Ubiquitin carboxyl-terminal hydrolase 8 isoform 2 [Theobroma cacao] gi|508785967|gb|EOY33223.1| Ubiquitin carboxyl-terminal hydrolase 8 isoform 2 [Theobroma cacao] Length = 892 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 93 PLLGQGEVASAFGDLLRKLWAPGATPVAPR 4 PL GE+ASAFGDLLRKLWAPGATPVAPR Sbjct: 334 PLGMNGEIASAFGDLLRKLWAPGATPVAPR 363 >ref|XP_007015603.1| Ubiquitin carboxyl-terminal hydrolase 8 isoform 1 [Theobroma cacao] gi|508785966|gb|EOY33222.1| Ubiquitin carboxyl-terminal hydrolase 8 isoform 1 [Theobroma cacao] Length = 915 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 93 PLLGQGEVASAFGDLLRKLWAPGATPVAPR 4 PL GE+ASAFGDLLRKLWAPGATPVAPR Sbjct: 357 PLGMNGEIASAFGDLLRKLWAPGATPVAPR 386 >ref|XP_003596922.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355485970|gb|AES67173.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 871 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 93 PLLGQGEVASAFGDLLRKLWAPGATPVAPRL 1 PL GE+ASAFGDLLRKLWAPGA+PVAPR+ Sbjct: 312 PLGMNGEIASAFGDLLRKLWAPGASPVAPRM 342