BLASTX nr result
ID: Akebia23_contig00052750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00052750 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316346.2| hypothetical protein POPTR_0010s22530g [Popu... 56 6e-06 >ref|XP_002316346.2| hypothetical protein POPTR_0010s22530g [Populus trichocarpa] gi|550330372|gb|EEF02517.2| hypothetical protein POPTR_0010s22530g [Populus trichocarpa] Length = 247 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 9/90 (10%) Frame = -3 Query: 245 KSKRSMSPAKKNNHNRILARKCN----FPVRKVT-----VRPKWNFFMFGLMKFPTNMKL 93 KS +++ NH + RKC+ F ++KV+ V+P+W F FG+ +FP M+L Sbjct: 137 KSDKALQVPLSENHG-LATRKCDDKNDFSMKKVSILVTPVKPRWYFSAFGVGRFPMEMEL 195 Query: 92 RDIRIRQSQLNRSSMFPSFGGGETVSVKRG 3 DI+ RQ++ + S MF S G E S KRG Sbjct: 196 SDIKTRQNKKSPSKMFQSEKGIEMSSKKRG 225