BLASTX nr result
ID: Akebia23_contig00051759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00051759 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS85074.1| hypothetical protein PFICI_03099 [Pestalotiopsis ... 58 2e-06 >gb|ETS85074.1| hypothetical protein PFICI_03099 [Pestalotiopsis fici W106-1] Length = 463 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -2 Query: 312 EKKERKAQGLP---FDKANRPNLSSLPSWLLTNSDCAVLSPSEERALELVA 169 EKK K LP F++A++P L+ LP+WLL NSDCAVLSP+EERAL L A Sbjct: 414 EKKAAK-NTLPLEAFNRASKPRLTDLPNWLLDNSDCAVLSPAEERALTLTA 463