BLASTX nr result
ID: Akebia23_contig00050925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00050925 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006431224.1| hypothetical protein CICLE_v10011685mg [Citr... 41 6e-07 >ref|XP_006431224.1| hypothetical protein CICLE_v10011685mg [Citrus clementina] gi|557533281|gb|ESR44464.1| hypothetical protein CICLE_v10011685mg [Citrus clementina] Length = 418 Score = 41.2 bits (95), Expect(2) = 6e-07 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = +2 Query: 218 RIDPLESSLHNILFSLYSSLSLGDPAVPIIQTHFRTLL 331 RID LE+SL N S SS SL D A +IQTHFR L Sbjct: 103 RIDALEASLQNFSLSPTSSFSLRDMAARVIQTHFRAFL 140 Score = 37.7 bits (86), Expect(2) = 6e-07 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = +1 Query: 403 GKRSIS*ELV*FLKFVD*ISVRKHDISSKATK 498 GKRS+S +L+ FL+FVD ++H+IS+KA K Sbjct: 162 GKRSVSKDLIKFLEFVDGFVAKRHEISTKAAK 193