BLASTX nr result
ID: Akebia23_contig00050564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00050564 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001800806.1| hypothetical protein SNOG_10538 [Phaeosphaer... 59 5e-07 >ref|XP_001800806.1| hypothetical protein SNOG_10538 [Phaeosphaeria nodorum SN15] gi|111060812|gb|EAT81932.1| hypothetical protein SNOG_10538 [Phaeosphaeria nodorum SN15] Length = 223 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 200 KLNPAVDAEAREAQEGWSETSQLNAAKGLGKDAGVGP 90 +L+PAVDA AREAQ+GWSE L A KGLGK++GVGP Sbjct: 71 RLDPAVDAHAREAQDGWSEEQSLKAGKGLGKESGVGP 107