BLASTX nr result
ID: Akebia23_contig00049016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00049016 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001802607.1| hypothetical protein SNOG_12384 [Phaeosphaer... 80 2e-13 gb|EON68184.1| hypothetical protein W97_07333 [Coniosporium apol... 80 3e-13 ref|XP_007588555.1| hypothetical protein UCRNP2_9320 [Neofusicoc... 80 3e-13 gb|EKG11813.1| hypothetical protein MPH_11309 [Macrophomina phas... 80 3e-13 gb|EOA88130.1| hypothetical protein SETTUDRAFT_168552 [Setosphae... 79 7e-13 ref|XP_003839807.1| hypothetical protein LEMA_P112470.1 [Leptosp... 78 1e-12 ref|XP_001936905.1| conserved hypothetical protein [Pyrenophora ... 78 1e-12 gb|EMD64456.1| hypothetical protein COCSADRAFT_37035 [Bipolaris ... 77 3e-12 gb|EMC99452.1| hypothetical protein BAUCODRAFT_128283 [Baudoinia... 74 3e-11 gb|EPE25289.1| hypothetical protein GLAREA_01201 [Glarea lozoyen... 72 1e-10 gb|EMF17780.1| hypothetical protein SEPMUDRAFT_146730 [Sphaeruli... 70 3e-10 ref|XP_001595919.1| hypothetical protein SS1G_02133 [Sclerotinia... 70 4e-10 ref|XP_001555112.1| hypothetical protein BC1G_06242 [Botryotinia... 70 4e-10 gb|EUC41279.1| hypothetical protein COCMIDRAFT_54488, partial [B... 69 7e-10 gb|ESZ91965.1| hypothetical protein SBOR_7655 [Sclerotinia borea... 69 9e-10 gb|EME50324.1| hypothetical protein DOTSEDRAFT_68999 [Dothistrom... 69 9e-10 ref|XP_006666933.1| hypothetical protein CCM_01715 [Cordyceps mi... 69 9e-10 gb|EME88056.1| hypothetical protein MYCFIDRAFT_55073 [Pseudocerc... 68 1e-09 gb|EXV05502.1| hypothetical protein X797_000217 [Metarhizium rob... 67 3e-09 gb|EJP66059.1| hypothetical protein BBA_05030 [Beauveria bassian... 67 3e-09 >ref|XP_001802607.1| hypothetical protein SNOG_12384 [Phaeosphaeria nodorum SN15] gi|111059077|gb|EAT80197.1| hypothetical protein SNOG_12384 [Phaeosphaeria nodorum SN15] Length = 112 Score = 80.5 bits (197), Expect = 2e-13 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFDQH F+CGDWKWGHF+QHC++EYRMGETCG Sbjct: 1 MCFFDQHRFACGDWKWGHFRQHCAKEYRMGETCG 34 >gb|EON68184.1| hypothetical protein W97_07333 [Coniosporium apollinis CBS 100218] Length = 114 Score = 80.1 bits (196), Expect = 3e-13 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFDQH F+CGDWKWGHF+QHC+REYR+GETCG Sbjct: 1 MCFFDQHRFACGDWKWGHFRQHCNREYRIGETCG 34 >ref|XP_007588555.1| hypothetical protein UCRNP2_9320 [Neofusicoccum parvum UCRNP2] gi|485916744|gb|EOD43943.1| hypothetical protein UCRNP2_9320 [Neofusicoccum parvum UCRNP2] Length = 114 Score = 80.1 bits (196), Expect = 3e-13 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFDQH F+CGDWKWGHF+QHC+REYR+GETCG Sbjct: 1 MCFFDQHRFACGDWKWGHFRQHCNREYRIGETCG 34 >gb|EKG11813.1| hypothetical protein MPH_11309 [Macrophomina phaseolina MS6] Length = 114 Score = 80.1 bits (196), Expect = 3e-13 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFDQH F+CGDWKWGHF+QHC+REYR+GETCG Sbjct: 1 MCFFDQHRFACGDWKWGHFRQHCNREYRIGETCG 34 >gb|EOA88130.1| hypothetical protein SETTUDRAFT_168552 [Setosphaeria turcica Et28A] Length = 111 Score = 79.0 bits (193), Expect = 7e-13 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCF+DQH F+CGDWKWGHF+QHCS+EYR+GETCG Sbjct: 1 MCFYDQHRFACGDWKWGHFRQHCSKEYRIGETCG 34 >ref|XP_003839807.1| hypothetical protein LEMA_P112470.1 [Leptosphaeria maculans JN3] gi|312216377|emb|CBX96328.1| hypothetical protein LEMA_P112470.1 [Leptosphaeria maculans JN3] Length = 111 Score = 77.8 bits (190), Expect = 1e-12 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCF+DQH F+CGDWKWGHF+QHC++EYR+GETCG Sbjct: 1 MCFYDQHRFACGDWKWGHFRQHCAKEYRIGETCG 34 >ref|XP_001936905.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330926988|ref|XP_003301692.1| hypothetical protein PTT_13262 [Pyrenophora teres f. teres 0-1] gi|187984004|gb|EDU49492.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311323366|gb|EFQ90208.1| hypothetical protein PTT_13262 [Pyrenophora teres f. teres 0-1] Length = 111 Score = 77.8 bits (190), Expect = 1e-12 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCF+DQH F+CGDWKWGHF+QHC++EYR+GETCG Sbjct: 1 MCFYDQHRFACGDWKWGHFRQHCAKEYRIGETCG 34 >gb|EMD64456.1| hypothetical protein COCSADRAFT_37035 [Bipolaris sorokiniana ND90Pr] gi|451996184|gb|EMD88651.1| hypothetical protein COCHEDRAFT_1142459 [Bipolaris maydis C5] gi|477588553|gb|ENI05632.1| hypothetical protein COCC4DRAFT_168635 [Bipolaris maydis ATCC 48331] gi|576913307|gb|EUC27756.1| hypothetical protein COCCADRAFT_110859 [Bipolaris zeicola 26-R-13] gi|576928917|gb|EUC42543.1| hypothetical protein COCMIDRAFT_7920 [Bipolaris oryzae ATCC 44560] gi|578487861|gb|EUN25312.1| hypothetical protein COCVIDRAFT_28071 [Bipolaris victoriae FI3] Length = 111 Score = 76.6 bits (187), Expect = 3e-12 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCF+DQH F CGDWKWGHF+QHC++EYR+GETCG Sbjct: 1 MCFYDQHRFVCGDWKWGHFRQHCAKEYRIGETCG 34 >gb|EMC99452.1| hypothetical protein BAUCODRAFT_128283 [Baudoinia compniacensis UAMH 10762] Length = 119 Score = 73.6 bits (179), Expect = 3e-11 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFD + FSCGDWKWG+F+QHC REYR GETCG Sbjct: 1 MCFFDMYKFSCGDWKWGNFRQHCQREYRTGETCG 34 >gb|EPE25289.1| hypothetical protein GLAREA_01201 [Glarea lozoyensis ATCC 20868] Length = 114 Score = 71.6 bits (174), Expect = 1e-10 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCF+DQH SCGD+KW HF+QHCS+EYR GETCG Sbjct: 1 MCFYDQHQMSCGDYKWSHFRQHCSKEYRTGETCG 34 >gb|EMF17780.1| hypothetical protein SEPMUDRAFT_146730 [Sphaerulina musiva SO2202] Length = 117 Score = 70.1 bits (170), Expect = 3e-10 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFF+ + FSC DWKWG+FKQHC+REYR+GETCG Sbjct: 1 MCFFECYKFSCRDWKWGNFKQHCNREYRIGETCG 34 >ref|XP_001595919.1| hypothetical protein SS1G_02133 [Sclerotinia sclerotiorum 1980] gi|154699543|gb|EDN99281.1| hypothetical protein SS1G_02133 [Sclerotinia sclerotiorum 1980 UF-70] Length = 111 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFDQ F CGD+KWGHF+QHC++EYR GETCG Sbjct: 1 MCFFDQCQFVCGDYKWGHFRQHCAKEYRTGETCG 34 >ref|XP_001555112.1| hypothetical protein BC1G_06242 [Botryotinia fuckeliana B05.10] gi|347833716|emb|CCD49413.1| hypothetical protein BofuT4_P027830.1 [Botryotinia fuckeliana T4] Length = 111 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFDQ F CGD+KWGHF+QHC++EYR GETCG Sbjct: 1 MCFFDQCQFVCGDYKWGHFRQHCAKEYRTGETCG 34 >gb|EUC41279.1| hypothetical protein COCMIDRAFT_54488, partial [Bipolaris oryzae ATCC 44560] Length = 106 Score = 68.9 bits (167), Expect = 7e-10 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCF+DQH F CG+WKW HF+QHC +E R+GETCG Sbjct: 1 MCFYDQHTFVCGNWKWVHFRQHCDKELRIGETCG 34 >gb|ESZ91965.1| hypothetical protein SBOR_7655 [Sclerotinia borealis F-4157] Length = 111 Score = 68.6 bits (166), Expect = 9e-10 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCFFDQ F+C D+KWGHF+QHC++EYR GETCG Sbjct: 1 MCFFDQCQFACNDYKWGHFRQHCAKEYRTGETCG 34 >gb|EME50324.1| hypothetical protein DOTSEDRAFT_68999 [Dothistroma septosporum NZE10] Length = 122 Score = 68.6 bits (166), Expect = 9e-10 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MC++D ++F C DWKWG+F+QHC+REYR GETCG Sbjct: 1 MCYYDNYIFHCRDWKWGNFRQHCNREYRTGETCG 34 >ref|XP_006666933.1| hypothetical protein CCM_01715 [Cordyceps militaris CM01] gi|346327460|gb|EGX97056.1| hypothetical protein CCM_01715 [Cordyceps militaris CM01] Length = 224 Score = 68.6 bits (166), Expect = 9e-10 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +3 Query: 219 LTMCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 LTMC+F+ ++SCG W+WGHF+Q C++EYRMGETCG Sbjct: 110 LTMCYFEMTLWSCGYWRWGHFRQQCNKEYRMGETCG 145 >gb|EME88056.1| hypothetical protein MYCFIDRAFT_55073 [Pseudocercospora fijiensis CIRAD86] Length = 117 Score = 68.2 bits (165), Expect = 1e-09 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MCF+D + FSC DWKWG+F+QHC +EYR GETCG Sbjct: 1 MCFYDMYKFSCRDWKWGNFRQHCQKEYRTGETCG 34 >gb|EXV05502.1| hypothetical protein X797_000217 [Metarhizium robertsii] Length = 112 Score = 67.0 bits (162), Expect = 3e-09 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MC+FDQ +SCG W+WGHF+Q C++EYRMGETCG Sbjct: 1 MCYFDQTRWSCGYWRWGHFRQQCNKEYRMGETCG 34 >gb|EJP66059.1| hypothetical protein BBA_05030 [Beauveria bassiana ARSEF 2860] Length = 177 Score = 67.0 bits (162), Expect = 3e-09 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +3 Query: 225 MCFFDQHVFSCGDWKWGHFKQHCSREYRMGETCG 326 MC+F+Q ++SCG W+WGHF+Q C++EYRMGETCG Sbjct: 1 MCYFEQTLWSCGYWRWGHFRQQCNKEYRMGETCG 34