BLASTX nr result
ID: Akebia23_contig00046662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00046662 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18358.1| B-cell receptor-associated 31-like protein [Macro... 74 3e-11 ref|XP_007588869.1| putative bap31 domain protein [Neofusicoccum... 71 2e-10 dbj|GAD92844.1| BAP31 domain protein, putative [Byssochlamys spe... 69 7e-10 ref|XP_003170964.1| receptor-associated protein [Arthroderma gyp... 66 6e-09 ref|XP_003011916.1| hypothetical protein ARB_01898 [Arthroderma ... 66 6e-09 gb|EZF26393.1| hypothetical protein H100_01455 [Trichophyton rub... 65 8e-09 gb|EZF26391.1| hypothetical protein H100_01455 [Trichophyton rub... 65 8e-09 gb|EGD97321.1| BAP31 domain-containing protein [Trichophyton ton... 65 8e-09 ref|XP_003232253.1| BAP31 domain-containing protein [Trichophyto... 65 8e-09 gb|EME46300.1| hypothetical protein DOTSEDRAFT_70333 [Dothistrom... 65 1e-08 gb|EMF14013.1| B-cell receptor-associated 31-like protein [Sphae... 65 1e-08 ref|XP_002844524.1| receptor-associated protein [Arthroderma ota... 64 2e-08 ref|XP_002479175.1| BAP31 domain protein, putative [Talaromyces ... 64 3e-08 gb|EME82978.1| hypothetical protein MYCFIDRAFT_182689 [Pseudocer... 63 5e-08 ref|XP_003023745.1| hypothetical protein TRV_02132 [Trichophyton... 63 5e-08 ref|XP_003856134.1| hypothetical protein MYCGRDRAFT_102248 [Zymo... 62 8e-08 gb|EON69451.1| hypothetical protein W97_08711 [Coniosporium apol... 62 1e-07 ref|XP_002146877.1| BAP31 domain protein, putative [Talaromyces ... 61 1e-07 ref|XP_002146876.1| BAP31 domain protein, putative [Talaromyces ... 61 1e-07 gb|EPE24225.1| hypothetical protein GLAREA_08075 [Glarea lozoyen... 60 2e-07 >gb|EKG18358.1| B-cell receptor-associated 31-like protein [Macrophomina phaseolina MS6] Length = 212 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKELE R+ LKKQ EGLSREYNRMGDQ+SGSD+TPKKD+ Sbjct: 166 IGRLKKELEAKDRDIANLKKQAEGLSREYNRMGDQISGSDSTPKKDR 212 >ref|XP_007588869.1| putative bap31 domain protein [Neofusicoccum parvum UCRNP2] gi|485916276|gb|EOD43658.1| putative bap31 domain protein [Neofusicoccum parvum UCRNP2] Length = 798 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKEL + R+ E LKKQ EGLSREYNR+GD+VSGSD+ PKKD+ Sbjct: 166 IGRLKKELADKDRDIEHLKKQAEGLSREYNRLGDEVSGSDSVPKKDR 212 >dbj|GAD92844.1| BAP31 domain protein, putative [Byssochlamys spectabilis No. 5] Length = 196 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKELE R+ E LKKQ EGLSREY+ +GDQVS SD+TPKKD+ Sbjct: 150 IGRLKKELEAKDRDIETLKKQAEGLSREYHNLGDQVSTSDDTPKKDR 196 >ref|XP_003170964.1| receptor-associated protein [Arthroderma gypseum CBS 118893] gi|311344753|gb|EFR03956.1| receptor-associated protein [Arthroderma gypseum CBS 118893] Length = 210 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/49 (65%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL+ + + EALKKQ+EGLSREYN++GD+VS DNTPKKD+ Sbjct: 162 IGRLKKELKARENDIEALKKQSEGLSREYNKLGDEVSAQNKDNTPKKDR 210 >ref|XP_003011916.1| hypothetical protein ARB_01898 [Arthroderma benhamiae CBS 112371] gi|291175470|gb|EFE31276.1| hypothetical protein ARB_01898 [Arthroderma benhamiae CBS 112371] Length = 307 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/49 (65%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL+ + + EALKKQ+EGLSREYN++GD+VS DNTPKKD+ Sbjct: 259 IGRLKKELKARENDIEALKKQSEGLSREYNKLGDEVSAQNKDNTPKKDR 307 >gb|EZF26393.1| hypothetical protein H100_01455 [Trichophyton rubrum MR850] gi|607908384|gb|EZF45422.1| hypothetical protein H102_01450 [Trichophyton rubrum CBS 100081] gi|607920463|gb|EZF56082.1| hypothetical protein H103_01462 [Trichophyton rubrum CBS 288.86] gi|607932503|gb|EZF66694.1| hypothetical protein H104_01440 [Trichophyton rubrum CBS 289.86] gi|607944577|gb|EZF77471.1| hypothetical protein H105_01468 [Trichophyton soudanense CBS 452.61] gi|607956530|gb|EZF87983.1| hypothetical protein H110_01460 [Trichophyton rubrum MR1448] gi|607968877|gb|EZF98918.1| hypothetical protein H113_01465 [Trichophyton rubrum MR1459] gi|607981047|gb|EZG09976.1| hypothetical protein H106_01228 [Trichophyton rubrum CBS 735.88] gi|607992748|gb|EZG20318.1| hypothetical protein H107_01510 [Trichophyton rubrum CBS 202.88] Length = 195 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/49 (63%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL+ + + EALKKQ+EGLSREYN++GD++S DNTPKKD+ Sbjct: 147 IGRLKKELKARENDIEALKKQSEGLSREYNKLGDEISSQNKDNTPKKDR 195 >gb|EZF26391.1| hypothetical protein H100_01455 [Trichophyton rubrum MR850] gi|607908382|gb|EZF45420.1| hypothetical protein H102_01450 [Trichophyton rubrum CBS 100081] gi|607920461|gb|EZF56080.1| hypothetical protein H103_01462 [Trichophyton rubrum CBS 288.86] gi|607932501|gb|EZF66692.1| hypothetical protein H104_01440 [Trichophyton rubrum CBS 289.86] gi|607944575|gb|EZF77469.1| hypothetical protein H105_01468 [Trichophyton soudanense CBS 452.61] gi|607956528|gb|EZF87981.1| hypothetical protein H110_01460 [Trichophyton rubrum MR1448] gi|607968875|gb|EZF98916.1| hypothetical protein H113_01465 [Trichophyton rubrum MR1459] gi|607981045|gb|EZG09974.1| hypothetical protein H106_01228 [Trichophyton rubrum CBS 735.88] gi|607992746|gb|EZG20316.1| hypothetical protein H107_01510 [Trichophyton rubrum CBS 202.88] Length = 212 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/49 (63%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL+ + + EALKKQ+EGLSREYN++GD++S DNTPKKD+ Sbjct: 164 IGRLKKELKARENDIEALKKQSEGLSREYNKLGDEISSQNKDNTPKKDR 212 >gb|EGD97321.1| BAP31 domain-containing protein [Trichophyton tonsurans CBS 112818] gi|326481993|gb|EGE06003.1| BAP31 domain-containing protein [Trichophyton equinum CBS 127.97] gi|607891708|gb|EZF31309.1| hypothetical protein H101_05069 [Trichophyton interdigitale H6] Length = 210 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/49 (63%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL+ + + EALKKQ+EGLSREYN++GD++S DNTPKKD+ Sbjct: 162 IGRLKKELKARENDIEALKKQSEGLSREYNKLGDEISSQNKDNTPKKDR 210 >ref|XP_003232253.1| BAP31 domain-containing protein [Trichophyton rubrum CBS 118892] gi|326465425|gb|EGD90878.1| BAP31 domain-containing protein [Trichophyton rubrum CBS 118892] gi|607881632|gb|EZF26392.1| hypothetical protein H100_01455 [Trichophyton rubrum MR850] gi|607908383|gb|EZF45421.1| hypothetical protein H102_01450 [Trichophyton rubrum CBS 100081] gi|607920462|gb|EZF56081.1| hypothetical protein H103_01462 [Trichophyton rubrum CBS 288.86] gi|607932502|gb|EZF66693.1| hypothetical protein H104_01440 [Trichophyton rubrum CBS 289.86] gi|607944576|gb|EZF77470.1| hypothetical protein H105_01468 [Trichophyton soudanense CBS 452.61] gi|607956529|gb|EZF87982.1| hypothetical protein H110_01460 [Trichophyton rubrum MR1448] gi|607968876|gb|EZF98917.1| hypothetical protein H113_01465 [Trichophyton rubrum MR1459] gi|607981046|gb|EZG09975.1| hypothetical protein H106_01228 [Trichophyton rubrum CBS 735.88] gi|607992747|gb|EZG20317.1| hypothetical protein H107_01510 [Trichophyton rubrum CBS 202.88] Length = 210 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/49 (63%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL+ + + EALKKQ+EGLSREYN++GD++S DNTPKKD+ Sbjct: 162 IGRLKKELKARENDIEALKKQSEGLSREYNKLGDEISSQNKDNTPKKDR 210 >gb|EME46300.1| hypothetical protein DOTSEDRAFT_70333 [Dothistroma septosporum NZE10] Length = 208 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKEL + R+ E +KKQ++GLS EYNR+GDQVS D+ PKKD+ Sbjct: 162 IGRLKKELAKRDRDIETMKKQSQGLSNEYNRLGDQVSAQDSVPKKDR 208 >gb|EMF14013.1| B-cell receptor-associated 31-like protein [Sphaerulina musiva SO2202] Length = 207 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKEL + ++ E LKKQ+EGLS EYNR+GDQVS D+ PKKD+ Sbjct: 161 IGRLKKELAKRDQDIETLKKQSEGLSNEYNRLGDQVSPQDSVPKKDR 207 >ref|XP_002844524.1| receptor-associated protein [Arthroderma otae CBS 113480] gi|238844007|gb|EEQ33669.1| receptor-associated protein [Arthroderma otae CBS 113480] Length = 212 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/49 (61%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL++ + + EALKKQ+EGLSREY ++GD++S DNTPKKD+ Sbjct: 164 IGRLKKELKDRENDIEALKKQSEGLSREYTKLGDEISAQNKDNTPKKDR 212 >ref|XP_002479175.1| BAP31 domain protein, putative [Talaromyces stipitatus ATCC 10500] gi|218722794|gb|EED22212.1| BAP31 domain protein, putative [Talaromyces stipitatus ATCC 10500] Length = 211 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKELE R+ E LKKQ EGL REY+ +GD+++ SDN PKKD+ Sbjct: 165 IGRLKKELEAKDRDIETLKKQAEGLQREYHNLGDKLTESDNAPKKDR 211 >gb|EME82978.1| hypothetical protein MYCFIDRAFT_182689 [Pseudocercospora fijiensis CIRAD86] Length = 210 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 I +LKK+L++ EALKKQ +GLS EYNR+GD+VS DNTPKKD+ Sbjct: 164 ISELKKQLKKKDVEIEALKKQAQGLSNEYNRLGDEVSAPDNTPKKDR 210 >ref|XP_003023745.1| hypothetical protein TRV_02132 [Trichophyton verrucosum HKI 0517] gi|291187755|gb|EFE43127.1| hypothetical protein TRV_02132 [Trichophyton verrucosum HKI 0517] Length = 329 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVS--GSDNTPKKDK 142 IG+LKKEL+ + + EALKKQ+EGLSREYN++GD+VS DNT KKD+ Sbjct: 281 IGRLKKELKARENDIEALKKQSEGLSREYNKLGDEVSAQNKDNTTKKDR 329 >ref|XP_003856134.1| hypothetical protein MYCGRDRAFT_102248 [Zymoseptoria tritici IPO323] gi|339476019|gb|EGP91110.1| hypothetical protein MYCGRDRAFT_102248 [Zymoseptoria tritici IPO323] Length = 208 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 I KLKKEL++ ++ E LKKQTEGL+REY RMGD VS D PKKD+ Sbjct: 162 ISKLKKELKKRDQDIETLKKQTEGLNREYQRMGDAVSEQDGGPKKDR 208 >gb|EON69451.1| hypothetical protein W97_08711 [Coniosporium apollinis CBS 100218] Length = 213 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKEL +R+ EALK QT REYNRMGDQ+S +D+ PKKD+ Sbjct: 167 IGRLKKELAARERDLEALKNQTASQQREYNRMGDQISPADSMPKKDR 213 >ref|XP_002146877.1| BAP31 domain protein, putative [Talaromyces marneffei ATCC 18224] gi|210072241|gb|EEA26330.1| BAP31 domain protein, putative [Talaromyces marneffei ATCC 18224] Length = 212 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKELE R+ E LKKQ EGL REY+ +GD+++ SD PKKD+ Sbjct: 166 IGRLKKELEAKDRDIETLKKQAEGLQREYHNLGDKLTESDKAPKKDR 212 >ref|XP_002146876.1| BAP31 domain protein, putative [Talaromyces marneffei ATCC 18224] gi|210072240|gb|EEA26329.1| BAP31 domain protein, putative [Talaromyces marneffei ATCC 18224] Length = 211 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKKELE R+ E LKKQ EGL REY+ +GD+++ SD PKKD+ Sbjct: 165 IGRLKKELEAKDRDIETLKKQAEGLQREYHNLGDKLTESDKAPKKDR 211 >gb|EPE24225.1| hypothetical protein GLAREA_08075 [Glarea lozoyensis ATCC 20868] Length = 211 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +2 Query: 2 IGKLKKELEEAKRNNEALKKQTEGLSREYNRMGDQVSGSDNTPKKDK 142 IG+LKK+L R+ +ALKKQ++GLS EYNR+GD+ S D TPKKD+ Sbjct: 165 IGELKKQLANKTRDFDALKKQSQGLSAEYNRLGDEKSPVDTTPKKDR 211