BLASTX nr result
ID: Akebia23_contig00046430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00046430 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006596427.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_006341986.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfam... 83 4e-14 ref|XP_004238610.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_006575412.1| PREDICTED: pentatricopeptide repeat-containi... 83 5e-14 ref|XP_007142200.1| hypothetical protein PHAVU_008G260600g [Phas... 82 1e-13 ref|XP_006435073.1| hypothetical protein CICLE_v10000229mg [Citr... 81 1e-13 ref|XP_003615696.1| Pentatricopeptide repeat-containing protein ... 81 2e-13 emb|CBI19766.3| unnamed protein product [Vitis vinifera] 80 4e-13 emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] 79 5e-13 ref|XP_006416469.1| hypothetical protein EUTSA_v10006756mg [Eutr... 79 5e-13 ref|NP_173402.2| pentatricopeptide repeat-containing protein [Ar... 79 5e-13 gb|EXB97347.1| hypothetical protein L484_024210 [Morus notabilis] 78 1e-12 tpg|DAA56491.1| TPA: hypothetical protein ZEAMMB73_164599 [Zea m... 78 1e-12 ref|XP_004970818.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 gb|EAZ14402.1| hypothetical protein OsJ_04322 [Oryza sativa Japo... 77 3e-12 gb|EAY76739.1| hypothetical protein OsI_04695 [Oryza sativa Indi... 77 3e-12 ref|NP_001172681.1| Os01g0884800 [Oryza sativa Japonica Group] g... 77 3e-12 gb|EYU32070.1| hypothetical protein MIMGU_mgv1a017635mg, partial... 77 3e-12 >ref|XP_006596427.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Glycine max] Length = 896 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMCRDCH TAK +SL YG EIYL DS C HHFK+G CSC DYW Sbjct: 849 IVKNLRMCRDCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 896 >ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Cicer arietinum] Length = 888 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMCRDCH TAK +SL YG EIYL DS C HHFK G CSC DYW Sbjct: 841 IVKNLRMCRDCHDTAKYISLAYGCEIYLSDSNCLHHFKGGHCSCRDYW 888 >ref|XP_006341986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Solanum tuberosum] Length = 884 Score = 83.2 bits (204), Expect = 4e-14 Identities = 36/62 (58%), Positives = 43/62 (69%) Frame = -2 Query: 223 FCMYPSKESCNRT*IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWD 44 F + S +S I KN RMC DCH+ AKLVS Y REIY++DSKC HHFK+G CSC + Sbjct: 823 FALINSPQSSRVIRIVKNLRMCEDCHRIAKLVSQKYEREIYIHDSKCLHHFKDGYCSCGN 882 Query: 43 YW 38 YW Sbjct: 883 YW 884 >ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590593723|ref|XP_007017650.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722977|gb|EOY14874.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722978|gb|EOY14875.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 890 Score = 83.2 bits (204), Expect = 4e-14 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMC +CH TAK +SL +G EIYL D KCFHHFKNGQCSC DYW Sbjct: 843 IVKNTRMCSNCHLTAKYISLKFGCEIYLSDRKCFHHFKNGQCSCGDYW 890 >ref|XP_004238610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Solanum lycopersicum] Length = 884 Score = 83.2 bits (204), Expect = 4e-14 Identities = 36/62 (58%), Positives = 43/62 (69%) Frame = -2 Query: 223 FCMYPSKESCNRT*IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWD 44 F + S +S I KN RMC DCH+ AKLVS Y REIY++DSKC HHFK+G CSC + Sbjct: 823 FALINSPQSSRVIRIVKNLRMCEDCHRIAKLVSQKYEREIYIHDSKCLHHFKDGYCSCGN 882 Query: 43 YW 38 YW Sbjct: 883 YW 884 >ref|XP_006575412.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like isoform X1 [Glycine max] gi|571441335|ref|XP_006575413.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like isoform X2 [Glycine max] Length = 896 Score = 82.8 bits (203), Expect = 5e-14 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMCRDCH +AK +SL YG EIYL DS C HHFK+G CSC DYW Sbjct: 849 IVKNLRMCRDCHDSAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 896 >ref|XP_007142200.1| hypothetical protein PHAVU_008G260600g [Phaseolus vulgaris] gi|561015333|gb|ESW14194.1| hypothetical protein PHAVU_008G260600g [Phaseolus vulgaris] Length = 893 Score = 81.6 bits (200), Expect = 1e-13 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN R+C+DCH TAK +SL YG EIYL DS C HHFK+G CSC DYW Sbjct: 846 IVKNLRVCKDCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 893 >ref|XP_006435073.1| hypothetical protein CICLE_v10000229mg [Citrus clementina] gi|557537195|gb|ESR48313.1| hypothetical protein CICLE_v10000229mg [Citrus clementina] Length = 889 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/66 (56%), Positives = 44/66 (66%) Frame = -2 Query: 235 LICIFCMYPSKESCNRT*IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQC 56 L F + S ++ + I KN RMC CHKTAK VS ++ EI+L DSKC HHFKNGQC Sbjct: 824 LALAFALIGSSQAPHTIRIVKNIRMCVHCHKTAKYVSKMHHCEIFLADSKCLHHFKNGQC 883 Query: 55 SCWDYW 38 SC DYW Sbjct: 884 SCGDYW 889 >ref|XP_003615696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517031|gb|AES98654.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 887 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I K RMCRDCH TAK +S+ YG EIYL DS C HHFK G CSC DYW Sbjct: 840 IVKKLRMCRDCHDTAKYISMAYGCEIYLSDSNCLHHFKGGHCSCRDYW 887 >emb|CBI19766.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMC DCH TAK +S++Y EIYL DSKC H FKNG+CSC DYW Sbjct: 447 IVKNLRMCGDCHGTAKFLSMLYSCEIYLSDSKCLHWFKNGRCSCGDYW 494 >emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] Length = 406 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMCRDCH TAK VS YG +I L D++C HHFKNG CSC DYW Sbjct: 359 ILKNLRMCRDCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 406 >ref|XP_006416469.1| hypothetical protein EUTSA_v10006756mg [Eutrema salsugineum] gi|557094240|gb|ESQ34822.1| hypothetical protein EUTSA_v10006756mg [Eutrema salsugineum] Length = 893 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMCRDCH TAK +S YG +I L D++C HHFKNG CSC DYW Sbjct: 846 ILKNLRMCRDCHNTAKYISRRYGCDILLEDTRCLHHFKNGDCSCKDYW 893 >ref|NP_173402.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75263158|sp|Q9FXH1.1|PPR52_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g19720; AltName: Full=Protein DYW7 gi|10086495|gb|AAG12555.1|AC007797_15 Unknown Protein [Arabidopsis thaliana] gi|332191770|gb|AEE29891.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 894 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 I KN RMCRDCH TAK VS YG +I L D++C HHFKNG CSC DYW Sbjct: 847 ILKNLRMCRDCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 894 >gb|EXB97347.1| hypothetical protein L484_024210 [Morus notabilis] Length = 880 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/59 (57%), Positives = 40/59 (67%) Frame = -2 Query: 214 YPSKESCNRT*IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 +P K C R I K+ RMC +CH+TAK +S YG EIY+ DSKC H F NG CSC DYW Sbjct: 824 FPRKAQCIR--IVKSLRMCGNCHETAKYISKTYGCEIYVTDSKCLHRFSNGHCSCKDYW 880 >tpg|DAA56491.1| TPA: hypothetical protein ZEAMMB73_164599 [Zea mays] Length = 520 Score = 78.2 bits (191), Expect = 1e-12 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 +FKN R+C DCH K+V+ +YGREI L D+ CFHH K+G+CSC DYW Sbjct: 473 VFKNLRVCGDCHTAIKMVAKVYGREIILRDANCFHHMKDGECSCGDYW 520 >ref|XP_004970818.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Setaria italica] Length = 517 Score = 77.0 bits (188), Expect = 3e-12 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 +FKN R+C DCH K+V+ +YGREI L D+ CFHH K+G CSC DYW Sbjct: 470 VFKNLRVCGDCHAAIKMVAKVYGREIILRDANCFHHMKDGACSCGDYW 517 >gb|EAZ14402.1| hypothetical protein OsJ_04322 [Oryza sativa Japonica Group] Length = 490 Score = 77.0 bits (188), Expect = 3e-12 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 ++KN R+C DCH K+V+ +YGREI L DS CFHH K+G CSC DYW Sbjct: 443 VYKNLRVCGDCHAAIKMVAEVYGREIILRDSNCFHHMKDGSCSCGDYW 490 >gb|EAY76739.1| hypothetical protein OsI_04695 [Oryza sativa Indica Group] Length = 494 Score = 77.0 bits (188), Expect = 3e-12 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 ++KN R+C DCH K+V+ +YGREI L DS CFHH K+G CSC DYW Sbjct: 447 VYKNLRVCGDCHAAIKMVAEVYGREIILRDSNCFHHMKDGSCSCGDYW 494 >ref|NP_001172681.1| Os01g0884800 [Oryza sativa Japonica Group] gi|20161229|dbj|BAB90156.1| selenium-binding protein-like [Oryza sativa Japonica Group] gi|255673935|dbj|BAH91411.1| Os01g0884800 [Oryza sativa Japonica Group] Length = 517 Score = 77.0 bits (188), Expect = 3e-12 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 ++KN R+C DCH K+V+ +YGREI L DS CFHH K+G CSC DYW Sbjct: 470 VYKNLRVCGDCHAAIKMVAEVYGREIILRDSNCFHHMKDGSCSCGDYW 517 >gb|EYU32070.1| hypothetical protein MIMGU_mgv1a017635mg, partial [Mimulus guttatus] Length = 728 Score = 76.6 bits (187), Expect = 3e-12 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -2 Query: 181 IFKNFRMCRDCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCWDYW 38 ++KN R+C DCH K VS +YGR I L DS CFHHF++G CSC DYW Sbjct: 681 VYKNIRVCGDCHTAMKFVSAVYGRRIVLRDSNCFHHFRDGVCSCLDYW 728