BLASTX nr result
ID: Akebia23_contig00046338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00046338 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF13258.1| hypothetical protein SEPMUDRAFT_148615 [Sphaeruli... 94 2e-17 gb|EMC98016.1| hypothetical protein BAUCODRAFT_47566, partial [B... 79 9e-13 gb|ETN40315.1| hypothetical protein HMPREF1541_04591 [Cyphelloph... 62 1e-07 >gb|EMF13258.1| hypothetical protein SEPMUDRAFT_148615 [Sphaerulina musiva SO2202] Length = 96 Score = 94.4 bits (233), Expect = 2e-17 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = -3 Query: 268 SNQQTGKVSHATGKSIVPQTLQEGLPEKVEKVVPNKIHDTKGATFSDGSVGK 113 SN +TGKVSHATG SIVP+TLQEGLPEKVEK+VPN IHDTKGATFSDGS GK Sbjct: 45 SNAKTGKVSHATGDSIVPKTLQEGLPEKVEKIVPNAIHDTKGATFSDGSKGK 96 >gb|EMC98016.1| hypothetical protein BAUCODRAFT_47566, partial [Baudoinia compniacensis UAMH 10762] Length = 83 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 268 SNQQTGKVSHATGKSIVPQTLQEGLPEKVEKVVPNKIHDTKGA 140 SN++TGKVSHATG+SIVPQ LQEGLPEKVEK+VPN IHDT GA Sbjct: 40 SNKETGKVSHATGQSIVPQALQEGLPEKVEKIVPNAIHDTSGA 82 >gb|ETN40315.1| hypothetical protein HMPREF1541_04591 [Cyphellophora europaea CBS 101466] Length = 84 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -3 Query: 268 SNQQTGKVSHATGKSIVPQTLQEGLPEKVEKVVPNKIHDT 149 SN++TGK SHA G S VPQ LQE LPE VEK VPN IHDT Sbjct: 42 SNKETGKESHAVGDSKVPQALQEALPESVEKAVPNAIHDT 81