BLASTX nr result
ID: Akebia23_contig00046053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00046053 (675 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera] 58 3e-06 emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera] 57 5e-06 >emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera] Length = 1365 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = -3 Query: 646 YHKGYQCLDPLSGKVFIPRYVIFDETCFPFVDRITKSPSIPKSLPSYFPSV 494 +HKGY CLD L+G+V++ +V+FDET FPF I+ SPS S S P++ Sbjct: 690 HHKGYLCLDNLTGRVYVSPHVVFDETQFPFAQNISSSPSKDASDESVIPAI 740 >emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera] Length = 1402 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -3 Query: 646 YHKGYQCLDPLSGKVFIPRYVIFDETCFPFVDRITKSPSIPKSLPSYFPSV 494 +HKGY CLD L+G+V++ +V+FDET FPF I+ SPS S S P + Sbjct: 740 HHKGYLCLDNLTGRVYVSPHVVFDETQFPFAQNISSSPSKDASDESIIPXI 790