BLASTX nr result
ID: Akebia23_contig00044251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00044251 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE25629.1| GroES-like protein [Glarea lozoyensis ATCC 20868] 100 2e-19 ref|XP_003004452.1| alcohol dehydrogenase [Verticillium alfalfae... 100 2e-19 gb|EOA86928.1| hypothetical protein SETTUDRAFT_115534 [Setosphae... 100 4e-19 ref|XP_001939279.1| alcohol dehydrogenase 1 [Pyrenophora tritici... 99 5e-19 ref|XP_003305011.1| hypothetical protein PTT_17745 [Pyrenophora ... 99 6e-19 ref|XP_003849721.1| hypothetical protein MYCGRDRAFT_101210 [Zymo... 99 8e-19 gb|ABK91799.1| Can a 1 allergen-like [Curvularia lunata] 97 2e-18 gb|EUC50616.1| hypothetical protein COCMIDRAFT_81326 [Bipolaris ... 97 2e-18 gb|EUC27815.1| hypothetical protein COCCADRAFT_30796 [Bipolaris ... 97 2e-18 gb|EMD95758.1| hypothetical protein COCHEDRAFT_1166191 [Bipolari... 97 2e-18 gb|EMD69370.1| hypothetical protein COCSADRAFT_105805 [Bipolaris... 97 2e-18 gb|EGY16343.1| alcohol dehydrogenase [Verticillium dahliae VdLs.17] 97 2e-18 ref|XP_003837280.1| similar to alcohol dehydrogenase [Leptosphae... 97 2e-18 ref|XP_001228112.1| alcohol dehydrogenase I [Chaetomium globosum... 96 4e-18 gb|EQB51166.1| hypothetical protein CGLO_09317 [Colletotrichum g... 96 4e-18 ref|XP_007283880.1| alcohol dehydrogenase i [Colletotrichum gloe... 96 4e-18 gb|EHK26611.1| hypothetical protein TRIVIDRAFT_215323 [Trichoder... 96 4e-18 gb|ETS83910.1| Alcohol dehydrogenase 1 [Pestalotiopsis fici W106-1] 96 5e-18 gb|ABC88428.1| alcohol dehydrogenase [Curvularia lunata] 96 5e-18 ref|XP_006968225.1| alcohol dehydrogenase [Trichoderma reesei QM... 96 5e-18 >gb|EPE25629.1| GroES-like protein [Glarea lozoyensis ATCC 20868] Length = 352 Score = 100 bits (250), Expect = 2e-19 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +3 Query: 186 MGQDIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 M QDIP EQWAQVI KTGGPVEYKKIPVQ+PGPDEVL+NIKYSGVCHTDL Sbjct: 1 MSQDIPKEQWAQVIHKTGGPVEYKKIPVQKPGPDEVLINIKYSGVCHTDL 50 >ref|XP_003004452.1| alcohol dehydrogenase [Verticillium alfalfae VaMs.102] gi|261357028|gb|EEY19456.1| alcohol dehydrogenase [Verticillium alfalfae VaMs.102] Length = 352 Score = 100 bits (250), Expect = 2e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +3 Query: 186 MGQDIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 MG DIP+EQWAQVIEKTGGPV YKKIPVQ+PGPDEVL+NIKYSGVCHTDL Sbjct: 1 MGADIPSEQWAQVIEKTGGPVVYKKIPVQKPGPDEVLINIKYSGVCHTDL 50 >gb|EOA86928.1| hypothetical protein SETTUDRAFT_115534 [Setosphaeria turcica Et28A] Length = 352 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 +IPTEQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 3 NIPTEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >ref|XP_001939279.1| alcohol dehydrogenase 1 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975372|gb|EDU41998.1| alcohol dehydrogenase 1 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 384 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 198 IPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 IPTEQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 36 IPTEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKYSGVCHTDL 81 >ref|XP_003305011.1| hypothetical protein PTT_17745 [Pyrenophora teres f. teres 0-1] gi|311318201|gb|EFQ86948.1| hypothetical protein PTT_17745 [Pyrenophora teres f. teres 0-1] Length = 352 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 +IPTEQWAQVIEKTGGPV+YKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 3 EIPTEQWAQVIEKTGGPVDYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >ref|XP_003849721.1| hypothetical protein MYCGRDRAFT_101210 [Zymoseptoria tritici IPO323] gi|339469598|gb|EGP84697.1| hypothetical protein MYCGRDRAFT_101210 [Zymoseptoria tritici IPO323] Length = 352 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 DIPTEQWAQV+EKTGGPV YKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 3 DIPTEQWAQVVEKTGGPVVYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >gb|ABK91799.1| Can a 1 allergen-like [Curvularia lunata] Length = 352 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 +IP EQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 3 NIPQEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >gb|EUC50616.1| hypothetical protein COCMIDRAFT_81326 [Bipolaris oryzae ATCC 44560] Length = 352 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 198 IPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 IP EQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 4 IPQEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >gb|EUC27815.1| hypothetical protein COCCADRAFT_30796 [Bipolaris zeicola 26-R-13] gi|578493172|gb|EUN30566.1| hypothetical protein COCVIDRAFT_89948 [Bipolaris victoriae FI3] Length = 352 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 198 IPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 IP EQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 4 IPQEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >gb|EMD95758.1| hypothetical protein COCHEDRAFT_1166191 [Bipolaris maydis C5] gi|477593548|gb|ENI10617.1| hypothetical protein COCC4DRAFT_55278 [Bipolaris maydis ATCC 48331] Length = 352 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 198 IPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 IP EQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 4 IPQEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >gb|EMD69370.1| hypothetical protein COCSADRAFT_105805 [Bipolaris sorokiniana ND90Pr] Length = 352 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 198 IPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 IP EQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 4 IPQEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKYSGVCHTDL 49 >gb|EGY16343.1| alcohol dehydrogenase [Verticillium dahliae VdLs.17] Length = 352 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +3 Query: 186 MGQDIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 MG DIP+EQWAQVIEKTGGPV Y KIP Q+PGPDEVL+NIKYSGVCHTDL Sbjct: 1 MGADIPSEQWAQVIEKTGGPVLYNKIPAQKPGPDEVLINIKYSGVCHTDL 50 >ref|XP_003837280.1| similar to alcohol dehydrogenase [Leptosphaeria maculans JN3] gi|312213838|emb|CBX93840.1| similar to alcohol dehydrogenase [Leptosphaeria maculans JN3] Length = 354 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 +IP EQWAQVIEKTGGPVEYKKIPV QPGPDEVLVNIKYSGVCHTDL Sbjct: 5 EIPKEQWAQVIEKTGGPVEYKKIPVPQPGPDEVLVNIKYSGVCHTDL 51 >ref|XP_001228112.1| alcohol dehydrogenase I [Chaetomium globosum CBS 148.51] gi|88176313|gb|EAQ83781.1| alcohol dehydrogenase I [Chaetomium globosum CBS 148.51] Length = 356 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 1/51 (1%) Frame = +3 Query: 186 MGQ-DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 MG+ +IPTEQWAQV+EK+GGPV YKKIPVQ+PGPDEVLVN+KYSGVCHTDL Sbjct: 1 MGEFEIPTEQWAQVVEKSGGPVSYKKIPVQKPGPDEVLVNVKYSGVCHTDL 51 >gb|EQB51166.1| hypothetical protein CGLO_09317 [Colletotrichum gloeosporioides Cg-14] Length = 352 Score = 96.3 bits (238), Expect = 4e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 186 MGQDIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 M ++PTEQWAQVIEKTGGP YKKIPVQ+PGPDEVL+N+KYSGVCHTDL Sbjct: 1 MATEVPTEQWAQVIEKTGGPAVYKKIPVQKPGPDEVLINVKYSGVCHTDL 50 >ref|XP_007283880.1| alcohol dehydrogenase i [Colletotrichum gloeosporioides Nara gc5] gi|429851886|gb|ELA27045.1| alcohol dehydrogenase i [Colletotrichum gloeosporioides Nara gc5] Length = 326 Score = 96.3 bits (238), Expect = 4e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 186 MGQDIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 M ++PTEQWAQVIEKTGGP YKKIPVQ+PGPDEVL+N+KYSGVCHTDL Sbjct: 1 MATEVPTEQWAQVIEKTGGPAVYKKIPVQKPGPDEVLINVKYSGVCHTDL 50 >gb|EHK26611.1| hypothetical protein TRIVIDRAFT_215323 [Trichoderma virens Gv29-8] Length = 353 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 DIP+EQWAQV+EKTGGPV YK+IPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 5 DIPSEQWAQVVEKTGGPVAYKRIPVQKPGPDEVLVNIKYSGVCHTDL 51 >gb|ETS83910.1| Alcohol dehydrogenase 1 [Pestalotiopsis fici W106-1] Length = 353 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +3 Query: 186 MGQDIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 M Q+IPTEQWAQV+E GGPV YKKIPVQ+PGPDEVL+NIKYSGVCHTDL Sbjct: 1 MSQEIPTEQWAQVVEAKGGPVVYKKIPVQKPGPDEVLINIKYSGVCHTDL 50 >gb|ABC88428.1| alcohol dehydrogenase [Curvularia lunata] Length = 352 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 +IP EQWAQVIEKTGGPVEYKKIPVQ+PGPDEVLVNIK+SGVCHTDL Sbjct: 3 NIPQEQWAQVIEKTGGPVEYKKIPVQKPGPDEVLVNIKFSGVCHTDL 49 >ref|XP_006968225.1| alcohol dehydrogenase [Trichoderma reesei QM6a] gi|340515654|gb|EGR45907.1| alcohol dehydrogenase [Trichoderma reesei QM6a] gi|572275517|gb|ETR98937.1| GroES-like protein [Trichoderma reesei RUT C-30] Length = 353 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +3 Query: 195 DIPTEQWAQVIEKTGGPVEYKKIPVQQPGPDEVLVNIKYSGVCHTDL 335 DIP+EQWAQV+EKTGGPV YK+IPVQ+PGPDEVLVNIKYSGVCHTDL Sbjct: 5 DIPSEQWAQVVEKTGGPVVYKRIPVQKPGPDEVLVNIKYSGVCHTDL 51