BLASTX nr result
ID: Akebia23_contig00044126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00044126 (519 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007905718.1| ribosomal protein S11 (mitochondrion) [Lirio... 65 1e-08 ref|YP_005090385.1| ribosomal protein S11 (mitochondrion) [Phoen... 64 3e-08 ref|XP_004975531.1| PREDICTED: 30S ribosomal protein S11, chloro... 62 1e-07 ref|NP_001148535.1| ribosomal protein S11 containing protein [Ze... 62 1e-07 gb|AHA47107.1| ribosomal protein S11 (mitochondrion) [Amborella ... 58 2e-06 ref|XP_006651450.1| PREDICTED: uncharacterized protein LOC102699... 57 2e-06 ref|XP_002441481.1| hypothetical protein SORBIDRAFT_09g027680 [S... 57 3e-06 dbj|BAA12798.1| mitochondrial ribosomal protein S11 [Oryza sativ... 56 4e-06 ref|NP_001050253.1| Os03g0385900 [Oryza sativa Japonica Group] g... 56 4e-06 gb|AAT85310.1| small subunit ribosomal protein, putative [Oryza ... 56 4e-06 ref|NP_001043554.1| Os01g0612100 [Oryza sativa Japonica Group] g... 55 1e-05 >ref|YP_007905718.1| ribosomal protein S11 (mitochondrion) [Liriodendron tulipifera] gi|480541922|gb|AGJ90415.1| ribosomal protein S11 (mitochondrion) [Liriodendron tulipifera] Length = 172 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 106 KSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 +SEGV QS+IMYIHDVTQLPHNGCRLPRKRRV Sbjct: 139 RSEGVGDQSQIMYIHDVTQLPHNGCRLPRKRRV 171 >ref|YP_005090385.1| ribosomal protein S11 (mitochondrion) [Phoenix dactylifera] gi|343478437|gb|AEM43925.1| ribosomal protein S11 (mitochondrion) [Phoenix dactylifera] Length = 171 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ EGV QS IMYIHDVTQLPHNGCRLP+KRRV Sbjct: 109 FRGEGVGDQSPIMYIHDVTQLPHNGCRLPKKRRV 142 >ref|XP_004975531.1| PREDICTED: 30S ribosomal protein S11, chloroplastic-like [Setaria italica] Length = 262 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR QS IMYIHDVTQLPHNGCRLP++RRV Sbjct: 229 FRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 262 >ref|NP_001148535.1| ribosomal protein S11 containing protein [Zea mays] gi|195620090|gb|ACG31875.1| ribosomal protein S11 containing protein [Zea mays] gi|223973845|gb|ACN31110.1| unknown [Zea mays] gi|413948359|gb|AFW81008.1| Ribosomal protein S11 containing protein isoform 1 [Zea mays] gi|413948360|gb|AFW81009.1| Ribosomal protein S11 containing protein isoform 2 [Zea mays] Length = 252 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR QS IMYIHDVTQLPHNGCRLP++RRV Sbjct: 219 FRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 252 >gb|AHA47107.1| ribosomal protein S11 (mitochondrion) [Amborella trichopoda] gi|567767317|gb|AHC94306.1| ribosomal protein S11 (mitochondrion) [Amborella trichopoda] Length = 167 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 106 KSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 +S GV S IMYIHDVTQLPHNGCRLPRKRRV Sbjct: 135 RSGGVGKTSFIMYIHDVTQLPHNGCRLPRKRRV 167 >ref|XP_006651450.1| PREDICTED: uncharacterized protein LOC102699577 [Oryza brachyantha] Length = 253 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR QS +++IHDVTQLPHNGCRLP++RR+ Sbjct: 220 FRGERVREQSPVVFIHDVTQLPHNGCRLPKQRRI 253 >ref|XP_002441481.1| hypothetical protein SORBIDRAFT_09g027680 [Sorghum bicolor] gi|241946766|gb|EES19911.1| hypothetical protein SORBIDRAFT_09g027680 [Sorghum bicolor] Length = 63 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR +S IMYIHDVTQLPHNGCRL ++RRV Sbjct: 30 FRGERVRDRSPIMYIHDVTQLPHNGCRLRKQRRV 63 >dbj|BAA12798.1| mitochondrial ribosomal protein S11 [Oryza sativa Japonica Group] gi|125586487|gb|EAZ27151.1| hypothetical protein OsJ_11086 [Oryza sativa Japonica Group] Length = 254 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR QS ++ IHDVTQLPHNGCRLP++RRV Sbjct: 221 FRGERVREQSPVVLIHDVTQLPHNGCRLPKQRRV 254 >ref|NP_001050253.1| Os03g0385900 [Oryza sativa Japonica Group] gi|108708513|gb|ABF96308.1| ribosomal protein S11 containing protein, expressed [Oryza sativa Japonica Group] gi|113548724|dbj|BAF12167.1| Os03g0385900 [Oryza sativa Japonica Group] gi|215706382|dbj|BAG93238.1| unnamed protein product [Oryza sativa Japonica Group] Length = 332 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR QS ++ IHDVTQLPHNGCRLP++RRV Sbjct: 299 FRGERVREQSPVVLIHDVTQLPHNGCRLPKQRRV 332 >gb|AAT85310.1| small subunit ribosomal protein, putative [Oryza sativa Japonica Group] Length = 366 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR QS ++ IHDVTQLPHNGCRLP++RRV Sbjct: 333 FRGERVREQSPVVLIHDVTQLPHNGCRLPKQRRV 366 >ref|NP_001043554.1| Os01g0612100 [Oryza sativa Japonica Group] gi|21104682|dbj|BAB93272.1| putative small subunit ribosomal protein [Oryza sativa Japonica Group] gi|113533085|dbj|BAF05468.1| Os01g0612100 [Oryza sativa Japonica Group] Length = 257 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 109 FKSEGVRGQSKIMYIHDVTQLPHNGCRLPRKRRV 8 F+ E VR QS +++IHDVTQLPHNGCRLP++R V Sbjct: 224 FRGERVREQSPVVFIHDVTQLPHNGCRLPKQRLV 257