BLASTX nr result
ID: Akebia23_contig00043567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00043567 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYE96916.1| hypothetical protein EURHEDRAFT_342644 [Aspergill... 68 1e-09 gb|EME46070.1| hypothetical protein DOTSEDRAFT_70157 [Dothistrom... 64 2e-08 ref|XP_003662257.1| hypothetical protein MYCTH_2302688 [Myceliop... 64 2e-08 ref|XP_003649864.1| hypothetical protein THITE_2108916 [Thielavi... 64 2e-08 gb|EME82944.1| hypothetical protein MYCFIDRAFT_211204 [Pseudocer... 63 4e-08 ref|XP_003299242.1| hypothetical protein PTT_10192 [Pyrenophora ... 62 6e-08 gb|EHK25739.1| hypothetical protein TRIVIDRAFT_55083 [Trichoderm... 62 8e-08 ref|XP_001935043.1| oxidoreductase domain containing protein [Py... 62 8e-08 gb|EQB53410.1| hypothetical protein CGLO_06847 [Colletotrichum g... 61 1e-07 ref|XP_001224709.1| hypothetical protein CHGG_07053 [Chaetomium ... 61 2e-07 ref|XP_006969028.1| predicted protein [Trichoderma reesei QM6a] ... 61 2e-07 gb|EMR65197.1| putative oxidoreductase domain containing protein... 60 3e-07 ref|XP_007279808.1| oxidoreductase domain containing protein [Co... 60 3e-07 gb|EKG11592.1| hypothetical protein MPH_11085 [Macrophomina phas... 60 3e-07 gb|EAS34844.2| hypothetical protein CIMG_00213 [Coccidioides imm... 60 3e-07 ref|XP_001246442.1| hypothetical protein CIMG_00213 [Coccidioide... 60 3e-07 ref|XP_006667727.1| oxidoreductase domain containing protein [Co... 60 4e-07 gb|ESZ97452.1| hypothetical protein SBOR_2141 [Sclerotinia borea... 59 7e-07 gb|ENH76933.1| oxidoreductase domain containing protein [Colleto... 59 7e-07 dbj|GAD95062.1| hypothetical protein ANI_1_1754184 [Byssochlamys... 58 1e-06 >gb|EYE96916.1| hypothetical protein EURHEDRAFT_342644 [Aspergillus ruber CBS 135680] Length = 275 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRK 144 PKAGS+L+FQHR+LLHSG +V QG KYTMRTD+MYRK Sbjct: 238 PKAGSVLVFQHRDLLHSGDSVFQGVKYTMRTDIMYRK 274 >gb|EME46070.1| hypothetical protein DOTSEDRAFT_70157 [Dothistroma septosporum NZE10] Length = 228 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMY 150 PK G +L+FQHR+LLHSG +VLQGTKYTMRTDLMY Sbjct: 176 PKTGRVLLFQHRDLLHSGDDVLQGTKYTMRTDLMY 210 >ref|XP_003662257.1| hypothetical protein MYCTH_2302688 [Myceliophthora thermophila ATCC 42464] gi|347009525|gb|AEO57012.1| hypothetical protein MYCTH_2302688 [Myceliophthora thermophila ATCC 42464] Length = 317 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMY 150 PKAG +LIFQHR LLHSG +VL+GTKYTMRTD+MY Sbjct: 274 PKAGRVLIFQHRRLLHSGDDVLRGTKYTMRTDIMY 308 >ref|XP_003649864.1| hypothetical protein THITE_2108916 [Thielavia terrestris NRRL 8126] gi|346997125|gb|AEO63528.1| hypothetical protein THITE_2108916 [Thielavia terrestris NRRL 8126] Length = 103 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRK 144 PKAG +LIFQHR LLHSG +VL GTKYTMRTD+MY + Sbjct: 40 PKAGRVLIFQHRRLLHSGDDVLAGTKYTMRTDIMYER 76 >gb|EME82944.1| hypothetical protein MYCFIDRAFT_211204 [Pseudocercospora fijiensis CIRAD86] Length = 278 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRK 144 PK G IL+FQHRNLLHSG +V+QG KYTMRTDL+Y + Sbjct: 226 PKTGRILLFQHRNLLHSGADVVQGVKYTMRTDLLYAR 262 >ref|XP_003299242.1| hypothetical protein PTT_10192 [Pyrenophora teres f. teres 0-1] gi|311327161|gb|EFQ92660.1| hypothetical protein PTT_10192 [Pyrenophora teres f. teres 0-1] Length = 255 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMY 150 PKAG +L+FQHRNL+HSG +V+ GTKYT+RTD+MY Sbjct: 212 PKAGRVLLFQHRNLIHSGDDVISGTKYTLRTDIMY 246 >gb|EHK25739.1| hypothetical protein TRIVIDRAFT_55083 [Trichoderma virens Gv29-8] Length = 258 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRKV 141 PKAGS+LIFQH LLH G V+QGTKYTMRT++MYR V Sbjct: 218 PKAGSVLIFQHPLLLHEGAEVIQGTKYTMRTEIMYRWV 255 >ref|XP_001935043.1| oxidoreductase domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980991|gb|EDU47617.1| oxidoreductase domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 255 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMY 150 PKAG +L+FQHRNL+HSG +V+ GTKYT+RTD+MY Sbjct: 212 PKAGRVLLFQHRNLIHSGDDVVSGTKYTLRTDIMY 246 >gb|EQB53410.1| hypothetical protein CGLO_06847 [Colletotrichum gloeosporioides Cg-14] Length = 297 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRKV 141 PKAG +LIFQH L HSG +V+QGTKYT+RTD++YR V Sbjct: 249 PKAGRVLIFQHNRLYHSGDDVIQGTKYTLRTDILYRLV 286 >ref|XP_001224709.1| hypothetical protein CHGG_07053 [Chaetomium globosum CBS 148.51] gi|88178332|gb|EAQ85800.1| hypothetical protein CHGG_07053 [Chaetomium globosum CBS 148.51] Length = 131 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMY 150 PKAG +LIFQHR LLHSG +VL G KYTMRTD+MY Sbjct: 87 PKAGRVLIFQHRRLLHSGDDVLAGIKYTMRTDIMY 121 >ref|XP_006969028.1| predicted protein [Trichoderma reesei QM6a] gi|340514863|gb|EGR45122.1| predicted protein [Trichoderma reesei QM6a] gi|572274701|gb|ETR98204.1| hypothetical protein M419DRAFT_103634 [Trichoderma reesei RUT C-30] Length = 262 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYR 147 PKAGS+LIFQH +LLH G VL+G KYTMRT++MYR Sbjct: 222 PKAGSVLIFQHPSLLHEGAEVLEGVKYTMRTEIMYR 257 >gb|EMR65197.1| putative oxidoreductase domain containing protein [Eutypa lata UCREL1] Length = 253 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRKV 141 PKAGS+LIFQ R+L H G +V +GTKYTMR D+MY+K+ Sbjct: 216 PKAGSVLIFQQRDLYHEGADVTRGTKYTMRADIMYKKI 253 >ref|XP_007279808.1| oxidoreductase domain containing protein [Colletotrichum gloeosporioides Nara gc5] gi|429856239|gb|ELA31162.1| oxidoreductase domain containing protein [Colletotrichum gloeosporioides Nara gc5] Length = 283 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRKV 141 PKAG +LIFQH L HSG +V+QGTKYT+RTD++Y+ V Sbjct: 235 PKAGRVLIFQHNRLYHSGDDVIQGTKYTLRTDILYKLV 272 >gb|EKG11592.1| hypothetical protein MPH_11085 [Macrophomina phaseolina MS6] Length = 135 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRK 144 PK G +LIFQHRN+ HSG +VL G KYTMRTD+MY K Sbjct: 94 PKVGRVLIFQHRNMAHSGDDVLVGVKYTMRTDVMYAK 130 >gb|EAS34844.2| hypothetical protein CIMG_00213 [Coccidioides immitis RS] Length = 208 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMY 150 PKAGS+LIFQHR+L HSG VLQG KYTMRTD+ Y Sbjct: 166 PKAGSVLIFQHRSLYHSGDLVLQGVKYTMRTDIYY 200 >ref|XP_001246442.1| hypothetical protein CIMG_00213 [Coccidioides immitis RS] Length = 191 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMY 150 PKAGS+LIFQHR+L HSG VLQG KYTMRTD+ Y Sbjct: 149 PKAGSVLIFQHRSLYHSGDLVLQGVKYTMRTDIYY 183 >ref|XP_006667727.1| oxidoreductase domain containing protein [Cordyceps militaris CM01] gi|346324644|gb|EGX94241.1| oxidoreductase domain containing protein [Cordyceps militaris CM01] Length = 276 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRKV 141 PKAG +L+FQHR LLH G V GTKYTMRTD++YR V Sbjct: 237 PKAGRVLVFQHRRLLHQGAEVQAGTKYTMRTDVLYRWV 274 >gb|ESZ97452.1| hypothetical protein SBOR_2141 [Sclerotinia borealis F-4157] Length = 364 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYR 147 PKAG +LIFQH+ LLHSG +V++G KYTMR+DLM+R Sbjct: 315 PKAGRVLIFQHKRLLHSGDDVVRGIKYTMRSDLMFR 350 >gb|ENH76933.1| oxidoreductase domain containing protein [Colletotrichum orbiculare MAFF 240422] Length = 273 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRKV 141 PKAG +LIFQH L HSG +VL GTKYTMRTD++Y+ V Sbjct: 234 PKAGRVLIFQHTMLYHSGDDVLAGTKYTMRTDILYKMV 271 >dbj|GAD95062.1| hypothetical protein ANI_1_1754184 [Byssochlamys spectabilis No. 5] Length = 293 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 254 PKAGSILIFQHRNLLHSGTNVLQGTKYTMRTDLMYRKV 141 PK GS+L+FQ RNL H+G +V +G KYT+RT++MYRKV Sbjct: 253 PKTGSVLLFQQRNLCHAGDDVYRGVKYTIRTEIMYRKV 290