BLASTX nr result
ID: Akebia23_contig00043483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00043483 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857341.1| hypothetical protein AMTR_s00067p00095130 [A... 67 2e-09 >ref|XP_006857341.1| hypothetical protein AMTR_s00067p00095130 [Amborella trichopoda] gi|548861434|gb|ERN18808.1| hypothetical protein AMTR_s00067p00095130 [Amborella trichopoda] Length = 773 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/49 (57%), Positives = 41/49 (83%) Frame = +2 Query: 5 QRVVAVETFVKNYMQMHPGVFPKASQVQKEVGGSWKLLKGILTELRESM 151 QR +A++TFVK YM ++PG FPKA+ V +EVGGSW +LK IL++L+E++ Sbjct: 35 QRTLAIKTFVKKYMMLNPGTFPKATLVHQEVGGSWYILKNILSDLKENL 83