BLASTX nr result
ID: Akebia23_contig00041715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00041715 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 58 1e-06 gb|EXB55739.1| Calmodulin-binding transcription activator 5 [Mor... 58 2e-06 gb|AEJ72569.1| putative reverse transcriptase family member [Mal... 56 5e-06 emb|CBL94165.1| putative reverse transcriptase family member [Ma... 56 5e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/53 (50%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 PIKLKEIFYKIAIR-SPIYGIECWVIKKQHVHRMSLSAMTILRRVSNTTRKKK 156 P+KLK FY+ AIR + +YG ECW +K QHVH+M ++ M +LR + TRK K Sbjct: 838 PLKLKGKFYRTAIRPAMLYGTECWAVKHQHVHKMGVAEMRMLRWMCGHTRKDK 890 >gb|EXB55739.1| Calmodulin-binding transcription activator 5 [Morus notabilis] Length = 1036 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 1 PIKLKEIFYKIAIR-SPIYGIECWVIKKQHVHRMSLSAMTILRRVSNTTR 147 PIKLKE FY+I IR + +YG ECWVIK+Q++ +MS++ M +LR +S TR Sbjct: 302 PIKLKEKFYRIVIRPTMLYGSECWVIKRQYICKMSVTEMRMLRWMSGHTR 351 >gb|AEJ72569.1| putative reverse transcriptase family member [Malus domestica] Length = 212 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +1 Query: 1 PIKLKEIFYKIAIR-SPIYGIECWVIKKQHVHRMSLSAMTILRRVSNTTRKKK 156 P+KLK FY+ IR + +YG ECW +K QHVH+M ++ M +LR + TRK K Sbjct: 64 PLKLKGKFYRTTIRPAMLYGTECWAVKYQHVHKMGVAEMRMLRWMCGHTRKDK 116 >emb|CBL94165.1| putative reverse transcriptase family member [Malus domestica] Length = 163 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +1 Query: 4 IKLKEIFYKIAIR-SPIYGIECWVIKKQHVHRMSLSAMTILRRVSNTTRKKK 156 +KLKE FY+ AIR + +Y IECW +K QHVH+M ++ + +LR + TRK K Sbjct: 17 LKLKEKFYRTAIRPAMLYDIECWAVKHQHVHKMGVAEIRMLRGMCRHTRKDK 68