BLASTX nr result
ID: Akebia23_contig00041631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00041631 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003710782.1| hypothetical protein MGG_04765 [Magnaporthe ... 59 7e-07 >ref|XP_003710782.1| hypothetical protein MGG_04765 [Magnaporthe oryzae 70-15] gi|351650311|gb|EHA58170.1| hypothetical protein MGG_04765 [Magnaporthe oryzae 70-15] Length = 495 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +1 Query: 1 TKLTELKDITGADRAGAGILTTLIIAGAVGAFTWMNLD 114 T +T KDITGADRAGAGILTTL+I A+G F WMN D Sbjct: 458 TPMTRYKDITGADRAGAGILTTLVIGSALGTFGWMNWD 495