BLASTX nr result
ID: Akebia23_contig00041454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00041454 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXK40550.1| 40S ribosomal protein S14 [Fusarium oxysporum f. ... 81 1e-13 gb|EXA46048.1| 40S ribosomal protein S14 [Fusarium oxysporum f. ... 81 1e-13 gb|EWY91793.1| 40S ribosomal protein S14 [Fusarium oxysporum FOS... 81 1e-13 gb|EWG49841.1| 40S ribosomal protein S14 [Fusarium verticillioid... 81 1e-13 ref|XP_001221627.1| 40S ribosomal protein S14 [Chaetomium globos... 81 1e-13 ref|XP_382717.1| RS14_NEUCR 40S ribosomal protein S14 (CRP2) [Fu... 81 1e-13 gb|EWC44424.1| 40S ribosomal protein S14 [Drechslerella stenobro... 81 1e-13 gb|ETN42629.1| 40S ribosomal protein S14 [Cyphellophora europaea... 81 1e-13 gb|EQK99798.1| Ribosomal protein S11 [Ophiocordyceps sinensis CO18] 81 1e-13 gb|EPS41235.1| hypothetical protein H072_4824 [Dactylellina hapt... 81 1e-13 gb|EON64822.1| 40S ribosomal protein S14 [Coniosporium apollinis... 81 1e-13 emb|CCE29737.1| probable 40S ribosomal protein S14 [Claviceps pu... 81 1e-13 ref|XP_007582655.1| putative 40s ribosomal protein s14 protein [... 81 1e-13 gb|EGX46801.1| hypothetical protein AOL_s00097g431 [Arthrobotrys... 81 1e-13 gb|EGU84837.1| hypothetical protein FOXB_04618 [Fusarium oxyspor... 81 1e-13 ref|XP_006965398.1| ribosomal protein S14, S11 family [Trichoder... 81 1e-13 gb|EFY85979.1| 40S ribosomal protein S14 (CRP2) [Metarhizium acr... 81 1e-13 ref|XP_003044867.1| 40S ribosomal protein S14 [Nectria haematoco... 81 1e-13 ref|XP_007598776.1| 40S ribosomal protein S14 [Colletotrichum fi... 80 3e-13 gb|ETI22809.1| 40S ribosomal protein S14 [Cladophialophora carri... 80 3e-13 >gb|EXK40550.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. melonis 26406] Length = 128 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 79 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 117 >gb|EXA46048.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. pisi HDV247] gi|590064512|gb|EXK92036.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. raphani 54005] gi|591443780|gb|EXL76333.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591467618|gb|EXL98989.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591492634|gb|EXM22230.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 125 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 76 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 114 >gb|EWY91793.1| 40S ribosomal protein S14 [Fusarium oxysporum FOSC 3-a] gi|587691853|gb|EWZ38458.1| 40S ribosomal protein S14 [Fusarium oxysporum Fo47] gi|587711681|gb|EWZ83018.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. lycopersici MN25] gi|591422783|gb|EXL57920.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 128 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 79 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 117 >gb|EWG49841.1| 40S ribosomal protein S14 [Fusarium verticillioides 7600] Length = 139 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 90 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 128 >ref|XP_001221627.1| 40S ribosomal protein S14 [Chaetomium globosum CBS 148.51] gi|88181445|gb|EAQ88913.1| 40S ribosomal protein S14 [Chaetomium globosum CBS 148.51] Length = 151 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 140 >ref|XP_382717.1| RS14_NEUCR 40S ribosomal protein S14 (CRP2) [Fusarium graminearum PH-1] gi|408391787|gb|EKJ71155.1| hypothetical protein FPSE_08661 [Fusarium pseudograminearum CS3096] gi|558857910|gb|ESU07993.1| 40S ribosomal protein S14 [Fusarium graminearum PH-1] gi|596552338|gb|EYB31709.1| hypothetical protein FG05_02541 [Fusarium graminearum] Length = 151 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 140 >gb|EWC44424.1| 40S ribosomal protein S14 [Drechslerella stenobrocha 248] Length = 152 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 103 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 141 >gb|ETN42629.1| 40S ribosomal protein S14 [Cyphellophora europaea CBS 101466] Length = 151 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 140 >gb|EQK99798.1| Ribosomal protein S11 [Ophiocordyceps sinensis CO18] Length = 150 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 101 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 139 >gb|EPS41235.1| hypothetical protein H072_4824 [Dactylellina haptotyla CBS 200.50] Length = 585 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 103 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 141 >gb|EON64822.1| 40S ribosomal protein S14 [Coniosporium apollinis CBS 100218] Length = 151 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 140 >emb|CCE29737.1| probable 40S ribosomal protein S14 [Claviceps purpurea 20.1] Length = 150 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 101 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 139 >ref|XP_007582655.1| putative 40s ribosomal protein s14 protein [Neofusicoccum parvum UCRNP2] gi|407927263|gb|EKG20161.1| Ribosomal protein S11 [Macrophomina phaseolina MS6] gi|485925251|gb|EOD49874.1| putative 40s ribosomal protein s14 protein [Neofusicoccum parvum UCRNP2] Length = 150 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 101 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 139 >gb|EGX46801.1| hypothetical protein AOL_s00097g431 [Arthrobotrys oligospora ATCC 24927] Length = 151 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 140 >gb|EGU84837.1| hypothetical protein FOXB_04618 [Fusarium oxysporum Fo5176] gi|475673535|gb|EMT70646.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. cubense race 4] gi|477522525|gb|ENH74592.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. cubense race 1] gi|517317920|emb|CCT68997.1| probable 40S ribosomal protein S14 [Fusarium fujikuroi IMI 58289] gi|584140506|gb|EWG49840.1| 40S ribosomal protein S14 [Fusarium verticillioides 7600] gi|587669451|gb|EWY91792.1| 40S ribosomal protein S14 [Fusarium oxysporum FOSC 3-a] gi|587691852|gb|EWZ38457.1| 40S ribosomal protein S14 [Fusarium oxysporum Fo47] gi|587711680|gb|EWZ83017.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587748331|gb|EXA46047.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. pisi HDV247] gi|590038691|gb|EXK40549.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. melonis 26406] gi|590064511|gb|EXK92035.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. raphani 54005] gi|591422782|gb|EXL57919.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591443779|gb|EXL76332.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591467617|gb|EXL98988.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591492633|gb|EXM22229.1| 40S ribosomal protein S14 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 151 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 140 >ref|XP_006965398.1| ribosomal protein S14, S11 family [Trichoderma reesei QM6a] gi|340518419|gb|EGR48660.1| ribosomal protein S14, S11 family [Trichoderma reesei QM6a] gi|358379982|gb|EHK17661.1| hypothetical protein TRIVIDRAFT_88725 [Trichoderma virens Gv29-8] gi|358399259|gb|EHK48602.1| hypothetical protein TRIATDRAFT_298038 [Trichoderma atroviride IMI 206040] gi|572278444|gb|ETS01636.1| 40S ribosomal protein S14 [Trichoderma reesei RUT C-30] Length = 149 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 100 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 138 >gb|EFY85979.1| 40S ribosomal protein S14 (CRP2) [Metarhizium acridum CQMa 102] gi|322710753|gb|EFZ02327.1| 40S ribosomal protein S14 (CRP2) [Metarhizium anisopliae ARSEF 23] gi|594722626|gb|EXV05512.1| 40S ribosomal protein S11 [Metarhizium robertsii] Length = 150 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 101 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 139 >ref|XP_003044867.1| 40S ribosomal protein S14 [Nectria haematococca mpVI 77-13-4] gi|256725792|gb|EEU39154.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 150 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST Sbjct: 101 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 139 >ref|XP_007598776.1| 40S ribosomal protein S14 [Colletotrichum fioriniae PJ7] gi|588896003|gb|EXF77563.1| 40S ribosomal protein S14 [Colletotrichum fioriniae PJ7] Length = 151 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALAR+GMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 140 >gb|ETI22809.1| 40S ribosomal protein S14 [Cladophialophora carrionii CBS 160.54] gi|589974910|gb|EXJ58211.1| 40S ribosomal protein S14 [Cladophialophora yegresii CBS 114405] Length = 151 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 353 GNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDST 237 GNGTKTPGPGAQSALRALAR+GMKIGRIEDVTPTPSDST Sbjct: 102 GNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 140