BLASTX nr result
ID: Akebia23_contig00040443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040443 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005504042.1| PREDICTED: E3 ubiquitin-protein ligase RNF13... 59 7e-07 gb|EXB65353.1| Uncharacterized RING finger protein [Morus notabi... 58 2e-06 ref|XP_002530030.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_007021463.1| Uncharacterized protein TCM_031493 [Theobrom... 57 4e-06 ref|XP_007212579.1| hypothetical protein PRUPE_ppa015864mg, part... 57 4e-06 gb|EMC88898.1| RING finger protein 13, partial [Columba livia] 57 4e-06 ref|XP_007144216.1| hypothetical protein PHAVU_007G137600g [Phas... 56 6e-06 ref|XP_004959421.1| PREDICTED: E3 ubiquitin-protein ligase EL5-l... 56 6e-06 ref|XP_006470483.1| PREDICTED: RING-H2 finger protein ATL46-like... 55 8e-06 >ref|XP_005504042.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Columba livia] Length = 331 Score = 58.9 bits (141), Expect = 7e-07 Identities = 21/43 (48%), Positives = 31/43 (72%) Frame = -3 Query: 198 DYKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICRNTLRDY 70 +YKEG+ C ++SC+H +H AC+ TWF + PTCPIC+ + Y Sbjct: 233 EYKEGE-CLKVLSCSHAYHGACIDTWFNTQPTCPICKQVVNTY 274 >gb|EXB65353.1| Uncharacterized RING finger protein [Morus notabilis] Length = 170 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -3 Query: 198 DYKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICRNTLR 76 D+K GD C + +SCNH FH+ACV W N CP+CR ++R Sbjct: 119 DFKYGDECRIFVSCNHGFHRACVDEWLVRNRHCPLCRGSVR 159 >ref|XP_002530030.1| conserved hypothetical protein [Ricinus communis] gi|223530446|gb|EEF32330.1| conserved hypothetical protein [Ricinus communis] Length = 164 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/40 (57%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -3 Query: 195 YKEGDPCWVLIS-CNHTFHKACVRTWFRSNPTCPICRNTL 79 +KEGD C VL+ CNHTFHK C+ WF +N +CP+CR L Sbjct: 125 FKEGDKCTVLLPYCNHTFHKGCIDPWFLNNNSCPLCRVVL 164 >ref|XP_007021463.1| Uncharacterized protein TCM_031493 [Theobroma cacao] gi|508721091|gb|EOY12988.1| Uncharacterized protein TCM_031493 [Theobroma cacao] Length = 255 Score = 56.6 bits (135), Expect = 4e-06 Identities = 18/37 (48%), Positives = 26/37 (70%) Frame = -3 Query: 198 DYKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICR 88 D+KE + CWVL+ C+H FHK C W + + +CP+CR Sbjct: 104 DFKEKEVCWVLVKCDHVFHKPCAEEWLKRSLSCPLCR 140 >ref|XP_007212579.1| hypothetical protein PRUPE_ppa015864mg, partial [Prunus persica] gi|462408444|gb|EMJ13778.1| hypothetical protein PRUPE_ppa015864mg, partial [Prunus persica] Length = 88 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/42 (50%), Positives = 28/42 (66%) Frame = -3 Query: 198 DYKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICRNTLRD 73 D++ C V SCNHTFH C+ TW + + TCPICRN++ D Sbjct: 46 DFETDQLCQVFPSCNHTFHSKCMNTWLKKSLTCPICRNSVLD 87 >gb|EMC88898.1| RING finger protein 13, partial [Columba livia] Length = 284 Score = 56.6 bits (135), Expect = 4e-06 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = -3 Query: 198 DYKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICRNTL 79 +YKEG+ C ++SC+H +H AC+ TWF + PTCPIC+ + Sbjct: 246 EYKEGE-CLKVLSCSHAYHGACIDTWFNTQPTCPICKQVV 284 >ref|XP_007144216.1| hypothetical protein PHAVU_007G137600g [Phaseolus vulgaris] gi|561017406|gb|ESW16210.1| hypothetical protein PHAVU_007G137600g [Phaseolus vulgaris] Length = 155 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 27/39 (69%) Frame = -3 Query: 198 DYKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICRNT 82 DYKEGD +L C+H FH AC+ W R +PTCPICR + Sbjct: 110 DYKEGDMLRLLPHCHHVFHLACLDPWLRLHPTCPICRKS 148 >ref|XP_004959421.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Setaria italica] Length = 148 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 25/39 (64%) Frame = -3 Query: 195 YKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICRNTL 79 Y+ GD C VL C H FHK CV WFR TCP+CR T+ Sbjct: 96 YEAGDACSVLPGCAHMFHKPCVAKWFRKKNTCPLCRATV 134 >ref|XP_006470483.1| PREDICTED: RING-H2 finger protein ATL46-like [Citrus sinensis] Length = 190 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = -3 Query: 198 DYKEGDPCWVLISCNHTFHKACVRTWFRSNPTCPICRNT 82 ++ +GD C +L CNH+FH CV W +NP CPICR+T Sbjct: 84 NFNKGDKCRLLPICNHSFHAQCVDAWLLTNPNCPICRST 122