BLASTX nr result
ID: Akebia23_contig00040384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040384 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001802021.1| hypothetical protein SNOG_11783 [Phaeosphaer... 97 3e-18 ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora ... 92 1e-16 gb|EOA90261.1| hypothetical protein SETTUDRAFT_158864 [Setosphae... 91 1e-16 ref|XP_001930380.1| glutaredoxin domain containing protein [Pyre... 90 3e-16 gb|EUN31078.1| hypothetical protein COCVIDRAFT_88740, partial [B... 88 1e-15 gb|EUC49386.1| hypothetical protein COCMIDRAFT_84672 [Bipolaris ... 88 1e-15 gb|EUC33727.1| hypothetical protein COCCADRAFT_95228, partial [B... 88 1e-15 gb|EMD60400.1| hypothetical protein COCSADRAFT_40040 [Bipolaris ... 88 1e-15 emb|CCU81873.1| glutaredoxin Grx1 [Blumeria graminis f. sp. hord... 87 2e-15 gb|EPQ66360.1| Cytoplasmic glutaredoxin thioltransferase glutath... 86 5e-15 ref|XP_003844117.1| similar to glutaredoxin [Leptosphaeria macul... 86 5e-15 ref|XP_003852675.1| putative P450 monooxygenase [Zymoseptoria tr... 85 9e-15 gb|EME48513.1| hypothetical protein DOTSEDRAFT_67524 [Dothistrom... 85 1e-14 gb|EON63519.1| glutaredoxin 3 [Coniosporium apollinis CBS 100218] 84 2e-14 ref|XP_002144051.1| glutaredoxin Grx1, putative [Talaromyces mar... 84 2e-14 gb|EMD90450.1| hypothetical protein COCHEDRAFT_1157461 [Bipolari... 84 2e-14 ref|XP_002480431.1| glutaredoxin Grx1, putative [Talaromyces sti... 84 2e-14 gb|EXJ63767.1| glutaredoxin 3 [Cladophialophora yegresii CBS 114... 84 3e-14 ref|XP_001265059.1| glutaredoxin, putative [Neosartorya fischeri... 84 3e-14 dbj|GAD96479.1| glutaredoxin Grx1, putative [Byssochlamys specta... 83 3e-14 >ref|XP_001802021.1| hypothetical protein SNOG_11783 [Phaeosphaeria nodorum SN15] gi|160703361|gb|EAT80827.2| hypothetical protein SNOG_11783 [Phaeosphaeria nodorum SN15] Length = 143 Score = 96.7 bits (239), Expect = 3e-18 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQSTLGE+TGQ TVPNIFI KEHIGGNS+LQAKK L +LLKDAGA+ Sbjct: 88 LDQVDDGSAIQSTLGEMTGQTTVPNIFIAKEHIGGNSDLQAKKNNLKTLLKDAGAL 143 >ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] gi|311326524|gb|EFQ92211.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] Length = 102 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/56 (76%), Positives = 52/56 (92%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSA+QS LG+LTGQ TVPNIFI ++HIGGNS+LQAKK +LP+LLK+AGA+ Sbjct: 47 LDQVDDGSAMQSVLGDLTGQTTVPNIFIAQKHIGGNSDLQAKKGELPNLLKEAGAL 102 >gb|EOA90261.1| hypothetical protein SETTUDRAFT_158864 [Setosphaeria turcica Et28A] Length = 134 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQ+ LGE+TGQ TVPNIFI ++HIGGNS+LQAKK QL +LLKDAGA+ Sbjct: 79 LDQVDDGSAIQAALGEITGQTTVPNIFIAQKHIGGNSDLQAKKGQLNTLLKDAGAL 134 >ref|XP_001930380.1| glutaredoxin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187971986|gb|EDU39485.1| glutaredoxin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 102 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/56 (75%), Positives = 52/56 (92%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSA+Q+ LG+LTGQ +VPNIFI ++HIGGNS+LQAKK +LP+LLK+AGAV Sbjct: 47 LDQVDDGSAMQAALGDLTGQTSVPNIFIAQKHIGGNSDLQAKKGELPNLLKEAGAV 102 >gb|EUN31078.1| hypothetical protein COCVIDRAFT_88740, partial [Bipolaris victoriae FI3] Length = 137 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQS L ++TGQ TVPNIFI ++HIGGNS+LQAKK +L +LLKDAGA+ Sbjct: 82 LDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 137 >gb|EUC49386.1| hypothetical protein COCMIDRAFT_84672 [Bipolaris oryzae ATCC 44560] Length = 138 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQS L ++TGQ TVPNIFI ++HIGGNS+LQAKK +L +LLKDAGA+ Sbjct: 83 LDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 138 >gb|EUC33727.1| hypothetical protein COCCADRAFT_95228, partial [Bipolaris zeicola 26-R-13] Length = 137 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQS L ++TGQ TVPNIFI ++HIGGNS+LQAKK +L +LLKDAGA+ Sbjct: 82 LDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 137 >gb|EMD60400.1| hypothetical protein COCSADRAFT_40040 [Bipolaris sorokiniana ND90Pr] Length = 102 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQS L ++TGQ TVPNIFI ++HIGGNS+LQAKK +L +LLKDAGA+ Sbjct: 47 LDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 102 >emb|CCU81873.1| glutaredoxin Grx1 [Blumeria graminis f. sp. hordei DH14] Length = 102 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQ+DDGSAIQ+ L E+ GQ+TVPNI+I K HIGGNS+LQ+KK LPSLLKDAGA+ Sbjct: 47 LDQIDDGSAIQAALKEINGQSTVPNIYINKVHIGGNSDLQSKKSTLPSLLKDAGAL 102 >gb|EPQ66360.1| Cytoplasmic glutaredoxin thioltransferase glutathione-dependent disulfide oxidoreductase [Blumeria graminis f. sp. tritici 96224] Length = 102 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQ+DDGS IQ+ L E+ GQ+TVPNI+I K HIGGNS+LQ+KK LPSLLKDAGA+ Sbjct: 47 LDQIDDGSTIQAALKEINGQSTVPNIYINKVHIGGNSDLQSKKSTLPSLLKDAGAL 102 >ref|XP_003844117.1| similar to glutaredoxin [Leptosphaeria maculans JN3] gi|312220697|emb|CBY00638.1| similar to glutaredoxin [Leptosphaeria maculans JN3] Length = 102 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/56 (69%), Positives = 51/56 (91%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQS LGE+TGQ TVP+IFI ++HIGGNS+LQ+K+++L ++LK AGA+ Sbjct: 47 LDQVDDGSAIQSALGEMTGQTTVPSIFIAQKHIGGNSDLQSKRRELKNMLKSAGAL 102 >ref|XP_003852675.1| putative P450 monooxygenase [Zymoseptoria tritici IPO323] gi|339472556|gb|EGP87651.1| putative P450 monooxygenase [Zymoseptoria tritici IPO323] Length = 101 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDG+AIQ L E+T Q +VPNIFI K+HIGGNSELQ+KK QLP+LLK+A A+ Sbjct: 46 LDQVDDGAAIQDALEEITSQRSVPNIFINKKHIGGNSELQSKKSQLPNLLKEANAI 101 >gb|EME48513.1| hypothetical protein DOTSEDRAFT_67524 [Dothistroma septosporum NZE10] Length = 101 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDG+AIQ L E+T Q +VPN+FI +HIGGNSELQAKK QLP LLK AGAV Sbjct: 46 LDQVDDGAAIQDALEEITNQRSVPNVFINHKHIGGNSELQAKKSQLPDLLKKAGAV 101 >gb|EON63519.1| glutaredoxin 3 [Coniosporium apollinis CBS 100218] Length = 102 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDG+AIQ L E+T Q TVPN+FI K+HIGGNS+LQ+KKK+LP LL+ AGAV Sbjct: 47 LDQVDDGAAIQDALEEMTHQRTVPNVFIDKKHIGGNSDLQSKKKELPKLLQTAGAV 102 >ref|XP_002144051.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] gi|212527790|ref|XP_002144052.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] gi|210073449|gb|EEA27536.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] gi|210073450|gb|EEA27537.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] Length = 102 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDG+AIQ L E+T Q +VPNIFI K+HIGGNS+LQA+K +LP LLKD GA+ Sbjct: 47 LDQVDDGAAIQDALEEITSQRSVPNIFINKQHIGGNSDLQARKNELPQLLKDVGAL 102 >gb|EMD90450.1| hypothetical protein COCHEDRAFT_1157461 [Bipolaris maydis C5] gi|477592266|gb|ENI09337.1| hypothetical protein COCC4DRAFT_127100 [Bipolaris maydis ATCC 48331] Length = 138 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/56 (71%), Positives = 49/56 (87%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDGSAIQS L ++TGQ TVPNIFI ++HIGGNS+LQAK+ +L +LLK AGA+ Sbjct: 83 LDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKRGELNTLLKGAGAL 138 >ref|XP_002480431.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] gi|242784658|ref|XP_002480432.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] gi|218720578|gb|EED19997.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] gi|218720579|gb|EED19998.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] Length = 102 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQVDDG+AIQ L E+T Q +VPNIFI K+HIGGNS+LQ +K +LP LLKDAGA+ Sbjct: 47 LDQVDDGAAIQDALEEITSQRSVPNIFINKQHIGGNSDLQGRKDELPQLLKDAGAL 102 >gb|EXJ63767.1| glutaredoxin 3 [Cladophialophora yegresii CBS 114405] Length = 102 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQV+DG+A+Q L E+TGQ +VPNIFIG+ HIGGNS+LQAKK QL LLK AGAV Sbjct: 47 LDQVEDGAALQDALEEITGQRSVPNIFIGQNHIGGNSDLQAKKSQLGDLLKSAGAV 102 >ref|XP_001265059.1| glutaredoxin, putative [Neosartorya fischeri NRRL 181] gi|119413221|gb|EAW23162.1| glutaredoxin, putative [Neosartorya fischeri NRRL 181] Length = 102 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/56 (69%), Positives = 49/56 (87%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LD++DDG+ IQ+ L E+T Q TVPNIFIG++HIGGNSELQAK QLP+LLK+AGA+ Sbjct: 47 LDEIDDGTEIQNALYEITQQRTVPNIFIGQKHIGGNSELQAKSAQLPALLKEAGAL 102 >dbj|GAD96479.1| glutaredoxin Grx1, putative [Byssochlamys spectabilis No. 5] Length = 103 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = -2 Query: 309 LDQVDDGSAIQSTLGELTGQATVPNIFIGKEHIGGNSELQAKKKQLPSLLKDAGAV 142 LDQ+DDG+AIQ L E+TGQ +VPNIFI K+HIGGNS+LQ++K +LP LLK AGA+ Sbjct: 48 LDQIDDGAAIQDALEEVTGQRSVPNIFINKQHIGGNSDLQSRKAELPELLKGAGAL 103