BLASTX nr result
ID: Akebia23_contig00040379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040379 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007026080.1| Homeodomain-like superfamily protein, putati... 59 9e-07 ref|XP_007026079.1| Homeodomain-like superfamily protein, putati... 59 9e-07 ref|XP_007026078.1| Homeodomain-like superfamily protein, putati... 59 9e-07 >ref|XP_007026080.1| Homeodomain-like superfamily protein, putative isoform 3 [Theobroma cacao] gi|508781446|gb|EOY28702.1| Homeodomain-like superfamily protein, putative isoform 3 [Theobroma cacao] Length = 1402 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 166 FNPFLKETSSPEASSNLSTENEGLGVDLVDNQGSSSVFKKTNLPSKLTDEVQD 8 FNPFLKET SPEASS+LS+E EGL D+VD++ + V K N PSK+ +VQ+ Sbjct: 55 FNPFLKETPSPEASSSLSSEIEGLDGDIVDSRAHTHVTKDVN-PSKINAKVQN 106 >ref|XP_007026079.1| Homeodomain-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|508781445|gb|EOY28701.1| Homeodomain-like superfamily protein, putative isoform 2 [Theobroma cacao] Length = 1374 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 166 FNPFLKETSSPEASSNLSTENEGLGVDLVDNQGSSSVFKKTNLPSKLTDEVQD 8 FNPFLKET SPEASS+LS+E EGL D+VD++ + V K N PSK+ +VQ+ Sbjct: 55 FNPFLKETPSPEASSSLSSEIEGLDGDIVDSRAHTHVTKDVN-PSKINAKVQN 106 >ref|XP_007026078.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508781444|gb|EOY28700.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 1463 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 166 FNPFLKETSSPEASSNLSTENEGLGVDLVDNQGSSSVFKKTNLPSKLTDEVQD 8 FNPFLKET SPEASS+LS+E EGL D+VD++ + V K N PSK+ +VQ+ Sbjct: 55 FNPFLKETPSPEASSSLSSEIEGLDGDIVDSRAHTHVTKDVN-PSKINAKVQN 106