BLASTX nr result
ID: Akebia23_contig00040194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040194 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004512449.1| PREDICTED: uncharacterized membrane protein ... 64 2e-08 ref|XP_003612662.1| Membrane protein, putative [Medicago truncat... 64 2e-08 ref|XP_002519965.1| Extensin-3 precursor, putative [Ricinus comm... 62 8e-08 ref|XP_003533453.1| PREDICTED: uncharacterized protein RSN1-like... 62 1e-07 ref|XP_007210357.1| hypothetical protein PRUPE_ppa001580mg [Prun... 61 1e-07 ref|XP_006432649.1| hypothetical protein CICLE_v10000312mg [Citr... 61 2e-07 gb|EPS60193.1| hypothetical protein M569_14609, partial [Genlise... 60 3e-07 ref|XP_007158205.1| hypothetical protein PHAVU_002G133000g [Phas... 60 4e-07 ref|XP_003516847.1| PREDICTED: uncharacterized protein RSN1-like... 60 4e-07 ref|XP_006368323.1| early-responsive to dehydration family prote... 59 7e-07 ref|XP_006352918.1| PREDICTED: uncharacterized protein RSN1-like... 59 9e-07 ref|XP_002304365.2| hypothetical protein POPTR_0003s09900g [Popu... 59 9e-07 ref|XP_004245915.1| PREDICTED: uncharacterized membrane protein ... 59 9e-07 ref|XP_007040777.1| Early-responsive to dehydration stress prote... 58 2e-06 ref|XP_007040776.1| Early-responsive to dehydration stress prote... 58 2e-06 ref|XP_006415254.1| hypothetical protein EUTSA_v10006831mg [Eutr... 57 3e-06 ref|NP_174489.1| early-responsive to dehydration stress protein ... 57 3e-06 gb|AFI41197.1| dehydration stress protein, partial [Arabidopsis ... 57 3e-06 ref|XP_002893699.1| hypothetical protein ARALYDRAFT_473392 [Arab... 57 3e-06 ref|XP_002273732.1| PREDICTED: uncharacterized protein RSN1 [Vit... 57 4e-06 >ref|XP_004512449.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cicer arietinum] Length = 798 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLNFKTYL LN MPQALR+ + EIINH GLDSAVFL +L Sbjct: 60 KFVNLNFKTYLTFLNWMPQALRMTETEIINHAGLDSAVFLRIYTL 104 >ref|XP_003612662.1| Membrane protein, putative [Medicago truncatula] gi|355513997|gb|AES95620.1| Membrane protein, putative [Medicago truncatula] Length = 799 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLNFKTYL LN MPQALR+ + EIINH GLDSAVFL +L Sbjct: 60 KFVNLNFKTYLTFLNWMPQALRMSETEIINHAGLDSAVFLRIYTL 104 >ref|XP_002519965.1| Extensin-3 precursor, putative [Ricinus communis] gi|223541011|gb|EEF42569.1| Extensin-3 precursor, putative [Ricinus communis] Length = 830 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLNFKTYL LN MPQA+R+ + +IINH GLDSA+FL +L Sbjct: 60 KFVNLNFKTYLTFLNWMPQAMRMSESQIINHAGLDSAIFLRIYTL 104 >ref|XP_003533453.1| PREDICTED: uncharacterized protein RSN1-like [Glycine max] Length = 799 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 7/65 (10%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISLR-------SLISSFT 159 +FVNLNF+TYL LN MPQALR+ + EII+H GLDSAVFL L +L++ F Sbjct: 61 KFVNLNFRTYLTFLNWMPQALRMSESEIISHAGLDSAVFLRIYILGFKVFAPITLVALFI 120 Query: 160 LITYN 174 LI N Sbjct: 121 LIPVN 125 >ref|XP_007210357.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica] gi|462406092|gb|EMJ11556.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica] Length = 799 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFL 120 +FVNLNFKTYL LN MPQA+++ + EIINH GLDSAVFL Sbjct: 60 KFVNLNFKTYLTFLNWMPQAMKMSESEIINHAGLDSAVFL 99 >ref|XP_006432649.1| hypothetical protein CICLE_v10000312mg [Citrus clementina] gi|568834714|ref|XP_006471456.1| PREDICTED: uncharacterized protein RSN1-like [Citrus sinensis] gi|557534771|gb|ESR45889.1| hypothetical protein CICLE_v10000312mg [Citrus clementina] Length = 807 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNL FKTYL LN MPQAL++ + EIINH GLDSAVFL +L Sbjct: 60 KFVNLEFKTYLTFLNWMPQALKMTESEIINHAGLDSAVFLRIYTL 104 >gb|EPS60193.1| hypothetical protein M569_14609, partial [Genlisea aurea] Length = 720 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFL 120 RFVNL+ KTYL LN MPQALR+ + EIINH GLDSAVFL Sbjct: 59 RFVNLDLKTYLTFLNWMPQALRMSEAEIINHAGLDSAVFL 98 >ref|XP_007158205.1| hypothetical protein PHAVU_002G133000g [Phaseolus vulgaris] gi|561031620|gb|ESW30199.1| hypothetical protein PHAVU_002G133000g [Phaseolus vulgaris] Length = 857 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLNF+TYL LN MPQALR+ + EII+H GLDSA FL +L Sbjct: 60 KFVNLNFRTYLTFLNWMPQALRMSESEIISHAGLDSAAFLRIYTL 104 >ref|XP_003516847.1| PREDICTED: uncharacterized protein RSN1-like [Glycine max] Length = 797 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLNF+TYL LN MPQALR+ + EII+H GLDSA FL +L Sbjct: 61 KFVNLNFRTYLTFLNWMPQALRMSESEIISHAGLDSAAFLRIYTL 105 >ref|XP_006368323.1| early-responsive to dehydration family protein [Populus trichocarpa] gi|550346228|gb|ERP64892.1| early-responsive to dehydration family protein [Populus trichocarpa] Length = 796 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLN KTY LN MPQAL++ + EIINH GLDSAVFL +L Sbjct: 60 KFVNLNVKTYFTFLNWMPQALKMTEAEIINHAGLDSAVFLRIYTL 104 >ref|XP_006352918.1| PREDICTED: uncharacterized protein RSN1-like [Solanum tuberosum] Length = 815 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLNFKTYL LN MPQA+++ + +II H GLDSAVFL +L Sbjct: 60 KFVNLNFKTYLTFLNWMPQAMQMSEAQIIEHAGLDSAVFLRIYTL 104 >ref|XP_002304365.2| hypothetical protein POPTR_0003s09900g [Populus trichocarpa] gi|550342850|gb|EEE79344.2| hypothetical protein POPTR_0003s09900g [Populus trichocarpa] Length = 808 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 + VNLN KTYL LN MPQAL++ + EIINH GLDSAVFL +L Sbjct: 60 KLVNLNIKTYLTFLNWMPQALKMSEAEIINHAGLDSAVFLRIYTL 104 >ref|XP_004245915.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Solanum lycopersicum] Length = 815 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLNFKTYL LN MPQA+++ + +II H GLDSAVFL +L Sbjct: 60 KFVNLNFKTYLTFLNWMPQAMQMSEAQIIEHAGLDSAVFLRIYTL 104 >ref|XP_007040777.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma cacao] gi|508778022|gb|EOY25278.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma cacao] Length = 804 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLN TYL LN MPQAL++ + EIINH GLDSAVFL +L Sbjct: 60 KFVNLNCMTYLTFLNWMPQALKMSETEIINHAGLDSAVFLRIYTL 104 >ref|XP_007040776.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma cacao] gi|508778021|gb|EOY25277.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma cacao] Length = 791 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLN TYL LN MPQAL++ + EIINH GLDSAVFL +L Sbjct: 60 KFVNLNCMTYLTFLNWMPQALKMSETEIINHAGLDSAVFLRIYTL 104 >ref|XP_006415254.1| hypothetical protein EUTSA_v10006831mg [Eutrema salsugineum] gi|557093025|gb|ESQ33607.1| hypothetical protein EUTSA_v10006831mg [Eutrema salsugineum] Length = 799 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLN+KTY LN MPQA+++ + EII H GLDSA+FL +L Sbjct: 61 KFVNLNYKTYFTFLNWMPQAMKMSEAEIIRHAGLDSAIFLRIYTL 105 >ref|NP_174489.1| early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] gi|10801377|gb|AAG23449.1|AC084165_15 hypothetical protein [Arabidopsis thaliana] gi|110738640|dbj|BAF01245.1| hypothetical protein [Arabidopsis thaliana] gi|332193314|gb|AEE31435.1| early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] Length = 806 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLN+KTY LN MPQA+++ + EII H GLDSA+FL +L Sbjct: 61 KFVNLNYKTYFTFLNWMPQAMKMSESEIIRHAGLDSAIFLRIYTL 105 >gb|AFI41197.1| dehydration stress protein, partial [Arabidopsis thaliana] Length = 806 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLN+KTY LN MPQA+++ + EII H GLDSA+FL +L Sbjct: 61 KFVNLNYKTYFTFLNWMPQAMKMSESEIIRHAGLDSAIFLRIYTL 105 >ref|XP_002893699.1| hypothetical protein ARALYDRAFT_473392 [Arabidopsis lyrata subsp. lyrata] gi|297339541|gb|EFH69958.1| hypothetical protein ARALYDRAFT_473392 [Arabidopsis lyrata subsp. lyrata] Length = 806 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 +FVNLN+KTY LN MPQA+++ + EII H GLDSA+FL +L Sbjct: 61 KFVNLNYKTYFTFLNWMPQAMKMSESEIIRHAGLDSAIFLRIYTL 105 >ref|XP_002273732.1| PREDICTED: uncharacterized protein RSN1 [Vitis vinifera] gi|296083383|emb|CBI23272.3| unnamed protein product [Vitis vinifera] Length = 772 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +1 Query: 1 RFVNLNFKTYLNSLN*MPQALRIYKFEIINHVGLDSAVFLEYISL 135 + VNLNF TYL LN MPQALR+ + EII H GLDSAVFL +L Sbjct: 60 KLVNLNFWTYLTFLNWMPQALRMSEAEIIQHAGLDSAVFLRIYTL 104