BLASTX nr result
ID: Akebia23_contig00039587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00039587 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE32683.1| hypothetical protein GLAREA_07817 [Glarea lozoyen... 59 7e-07 gb|EMC98991.1| hypothetical protein BAUCODRAFT_154675 [Baudoinia... 57 3e-06 ref|XP_001585317.1| hypothetical protein SS1G_13556 [Sclerotinia... 55 8e-06 >gb|EPE32683.1| hypothetical protein GLAREA_07817 [Glarea lozoyensis ATCC 20868] Length = 306 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -3 Query: 237 NKSSE-FSSSDSHGKKNDSTVGKLMEKAGSALGNEKLAAKGAEKRAQQGADTYGSG 73 N++S+ + ++ G K DST+GKLMEKAG L NE L KG +KRA G D YGSG Sbjct: 242 NRTSDGYGDNEGSGGKKDSTMGKLMEKAGGMLKNEGLVEKGQQKRAGAGNDEYGSG 297 >gb|EMC98991.1| hypothetical protein BAUCODRAFT_154675 [Baudoinia compniacensis UAMH 10762] Length = 297 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -3 Query: 219 SSSDSHGKKNDSTVGKLMEKAGSALGNEKLAAKGAEKRAQQGAD 88 SSS HG++ DS +GK+M+KAG +GN+KLA+KGAEKR D Sbjct: 251 SSSGRHGQQKDSMMGKMMQKAGDMMGNDKLASKGAEKRGMNAGD 294 >ref|XP_001585317.1| hypothetical protein SS1G_13556 [Sclerotinia sclerotiorum 1980] gi|154698959|gb|EDN98697.1| hypothetical protein SS1G_13556 [Sclerotinia sclerotiorum 1980 UF-70] Length = 304 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -3 Query: 219 SSSDSHGKKNDSTVGKLMEKAGSALGNEKLAAKGAEKRAQQGADTY 82 +SS++ GK DST+GK+MEKAG L E L KGAEKRA G D Y Sbjct: 259 TSSNNTGKSGDSTMGKIMEKAGGMLHKESLVQKGAEKRAAAGNDNY 304