BLASTX nr result
ID: Akebia23_contig00039045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00039045 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17966.1| hypothetical protein MIMGU_mgv1a000215mg [Mimulus... 57 3e-06 ref|XP_007162647.1| hypothetical protein PHAVU_001G168400g [Phas... 57 3e-06 ref|XP_007200950.1| hypothetical protein PRUPE_ppa000220mg [Prun... 57 3e-06 ref|XP_003554315.1| PREDICTED: CLIP-associated protein-like [Gly... 57 3e-06 ref|XP_004290027.1| PREDICTED: CLIP-associating protein 1-like [... 57 4e-06 gb|EXC24139.1| CLIP-associating protein 1-B [Morus notabilis] 56 6e-06 ref|XP_006350293.1| PREDICTED: CLIP-associated protein-like [Sol... 56 6e-06 ref|XP_004247112.1| PREDICTED: CLIP-associating protein 1-B-like... 56 6e-06 ref|XP_004247111.1| PREDICTED: CLIP-associating protein 1-B-like... 56 6e-06 ref|XP_006443676.1| hypothetical protein CICLE_v10018498mg [Citr... 55 8e-06 ref|XP_003521327.1| PREDICTED: CLIP-associated protein-like [Gly... 55 8e-06 >gb|EYU17966.1| hypothetical protein MIMGU_mgv1a000215mg [Mimulus guttatus] Length = 1420 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLEASRKTMS EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEASRKTMSPPEVT 40 >ref|XP_007162647.1| hypothetical protein PHAVU_001G168400g [Phaseolus vulgaris] gi|561036111|gb|ESW34641.1| hypothetical protein PHAVU_001G168400g [Phaseolus vulgaris] Length = 1445 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLEASRK++SS+EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEASRKSLSSSEVT 40 >ref|XP_007200950.1| hypothetical protein PRUPE_ppa000220mg [Prunus persica] gi|462396350|gb|EMJ02149.1| hypothetical protein PRUPE_ppa000220mg [Prunus persica] Length = 1444 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLEASRK++SS+EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEASRKSLSSSEVT 40 >ref|XP_003554315.1| PREDICTED: CLIP-associated protein-like [Glycine max] Length = 1444 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLEASRK++SS+EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEASRKSLSSSEVT 40 >ref|XP_004290027.1| PREDICTED: CLIP-associating protein 1-like [Fragaria vesca subsp. vesca] Length = 1439 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLEASRK++SS EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEASRKSLSSAEVT 40 >gb|EXC24139.1| CLIP-associating protein 1-B [Morus notabilis] Length = 1471 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLEASRK+++S+EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEASRKSLTSSEVT 40 >ref|XP_006350293.1| PREDICTED: CLIP-associated protein-like [Solanum tuberosum] Length = 1429 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLH+LLEASRK++SS+EVT Sbjct: 9 RAKDTKERMAGVERLHELLEASRKSLSSSEVT 40 >ref|XP_004247112.1| PREDICTED: CLIP-associating protein 1-B-like isoform 2 [Solanum lycopersicum] Length = 1388 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLH+LLEASRK++SS+EVT Sbjct: 9 RAKDTKERMAGVERLHELLEASRKSLSSSEVT 40 >ref|XP_004247111.1| PREDICTED: CLIP-associating protein 1-B-like isoform 1 [Solanum lycopersicum] Length = 1426 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLH+LLEASRK++SS+EVT Sbjct: 9 RAKDTKERMAGVERLHELLEASRKSLSSSEVT 40 >ref|XP_006443676.1| hypothetical protein CICLE_v10018498mg [Citrus clementina] gi|568853044|ref|XP_006480177.1| PREDICTED: CLIP-associated protein-like [Citrus sinensis] gi|557545938|gb|ESR56916.1| hypothetical protein CICLE_v10018498mg [Citrus clementina] Length = 1418 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLEASRK+++S EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEASRKSLTSAEVT 40 >ref|XP_003521327.1| PREDICTED: CLIP-associated protein-like [Glycine max] Length = 1440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 154 RSKDTKERMVGVERLHQLLEASRKTMSSTEVT 249 R+KDTKERM GVERLHQLLE SRK++SS+EVT Sbjct: 9 RAKDTKERMAGVERLHQLLEVSRKSLSSSEVT 40