BLASTX nr result
ID: Akebia23_contig00038210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00038210 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285886.1| PREDICTED: probable calcium-binding protein ... 68 2e-09 ref|XP_006472871.1| PREDICTED: probable calcium-binding protein ... 67 2e-09 ref|XP_006434301.1| hypothetical protein CICLE_v10002706mg [Citr... 67 2e-09 ref|XP_006365434.1| PREDICTED: probable calcium-binding protein ... 65 1e-08 ref|XP_004237356.1| PREDICTED: probable calcium-binding protein ... 65 1e-08 ref|XP_006472872.1| PREDICTED: probable calcium-binding protein ... 64 2e-08 ref|XP_006434302.1| hypothetical protein CICLE_v10002693mg [Citr... 64 2e-08 ref|XP_002520298.1| calcium binding protein/cast, putative [Rici... 64 2e-08 ref|XP_007019238.1| Calcium-binding EF-hand family protein [Theo... 64 3e-08 gb|ABO41848.1| putative calcium-binding protein [Gossypium hirsu... 63 4e-08 ref|XP_002306659.1| calcium-binding family protein [Populus tric... 60 2e-07 ref|XP_002302215.1| calcium-binding family protein [Populus tric... 60 2e-07 gb|EYU32485.1| hypothetical protein MIMGU_mgv1a017161mg [Mimulus... 59 7e-07 ref|XP_003542013.1| PREDICTED: probable calcium-binding protein ... 58 2e-06 gb|EYU32486.1| hypothetical protein MIMGU_mgv1a015295mg [Mimulus... 57 3e-06 ref|XP_007161420.1| hypothetical protein PHAVU_001G067400g [Phas... 56 5e-06 ref|XP_003589594.1| Calmodulin-like protein [Medicago truncatula... 55 8e-06 >ref|XP_002285886.1| PREDICTED: probable calcium-binding protein CML44-like [Vitis vinifera] Length = 162 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLT 122 LG+WEE GGDC+ MI +DTNSDGVLDF+EFKNMMLL+ Sbjct: 122 LGMWEENGGGDCRSMIKVYDTNSDGVLDFEEFKNMMLLS 160 >ref|XP_006472871.1| PREDICTED: probable calcium-binding protein CML44-like [Citrus sinensis] Length = 166 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+EKSG DC RMI +DTN DGVLDF+EFKNMMLL+ S Sbjct: 126 LGLWDEKSGKDCTRMICMYDTNLDGVLDFEEFKNMMLLSKS 166 >ref|XP_006434301.1| hypothetical protein CICLE_v10002706mg [Citrus clementina] gi|557536423|gb|ESR47541.1| hypothetical protein CICLE_v10002706mg [Citrus clementina] Length = 166 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+EKSG DC RMI +DTN DGVLDF+EFKNMMLL+ S Sbjct: 126 LGLWDEKSGKDCTRMICMYDTNLDGVLDFEEFKNMMLLSKS 166 >ref|XP_006365434.1| PREDICTED: probable calcium-binding protein CML44-like [Solanum tuberosum] Length = 157 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+EK G DCK MI +DTN DGVLDF+EFKNMML++ S Sbjct: 117 LGLWDEKEGSDCKNMIHMYDTNLDGVLDFEEFKNMMLVSNS 157 >ref|XP_004237356.1| PREDICTED: probable calcium-binding protein CML44-like [Solanum lycopersicum] Length = 158 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+EK G DCK MI +DTN DGVLDF+EFKNMML++ S Sbjct: 118 LGLWDEKEGSDCKNMIHMYDTNLDGVLDFEEFKNMMLVSKS 158 >ref|XP_006472872.1| PREDICTED: probable calcium-binding protein CML44-like [Citrus sinensis] Length = 169 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMML 128 LGLW+EKS DC+ MI +DTNSDGVLDF+EFKNMML Sbjct: 128 LGLWDEKSSQDCRSMIYVYDTNSDGVLDFEEFKNMML 164 >ref|XP_006434302.1| hypothetical protein CICLE_v10002693mg [Citrus clementina] gi|557536424|gb|ESR47542.1| hypothetical protein CICLE_v10002693mg [Citrus clementina] Length = 169 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMML 128 LGLW+EKS DC+ MI +DTNSDGVLDF+EFKNMML Sbjct: 128 LGLWDEKSSQDCRSMIYVYDTNSDGVLDFEEFKNMML 164 >ref|XP_002520298.1| calcium binding protein/cast, putative [Ricinus communis] gi|223540517|gb|EEF42084.1| calcium binding protein/cast, putative [Ricinus communis] Length = 165 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+E SG DC MI FDTN DGVLDF+EFKNMML T S Sbjct: 125 LGLWDEMSGKDCTSMICAFDTNLDGVLDFEEFKNMMLQTSS 165 >ref|XP_007019238.1| Calcium-binding EF-hand family protein [Theobroma cacao] gi|508724566|gb|EOY16463.1| Calcium-binding EF-hand family protein [Theobroma cacao] Length = 191 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+E SG DC+ MI +DTN DG++DF+EFKNMML TIS Sbjct: 151 LGLWDESSGKDCRNMICFYDTNLDGMVDFEEFKNMMLHTIS 191 >gb|ABO41848.1| putative calcium-binding protein [Gossypium hirsutum] Length = 172 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+EK+G DC+ MI +DTN DG++DF+EFKNMML ++S Sbjct: 132 LGLWDEKNGKDCRNMICFYDTNLDGMIDFEEFKNMMLRSVS 172 >ref|XP_002306659.1| calcium-binding family protein [Populus trichocarpa] gi|222856108|gb|EEE93655.1| calcium-binding family protein [Populus trichocarpa] Length = 161 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LGLW+E +G DC+ MI +DTN DGVLDF+EFK MML T S Sbjct: 121 LGLWDETTGKDCRSMICRYDTNLDGVLDFEEFKKMMLHTSS 161 >ref|XP_002302215.1| calcium-binding family protein [Populus trichocarpa] gi|222843941|gb|EEE81488.1| calcium-binding family protein [Populus trichocarpa] Length = 160 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLT 122 LGLW+EK+G DC+ M+ +DTN DGV+DF+EFK MML T Sbjct: 120 LGLWDEKTGKDCRSMLCRYDTNLDGVVDFEEFKKMMLRT 158 >gb|EYU32485.1| hypothetical protein MIMGU_mgv1a017161mg [Mimulus guttatus] Length = 90 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMM 131 LGLWE++SG DCK MI +D N DGVLDF+EFKNMM Sbjct: 46 LGLWEKRSGQDCKDMIRVYDENLDGVLDFEEFKNMM 81 >ref|XP_003542013.1| PREDICTED: probable calcium-binding protein CML44-like [Glycine max] Length = 164 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -3 Query: 238 LGLWE-EKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LG+W+ E+ G DCK MI +DTN DG LDF+EFK+MMLLT S Sbjct: 123 LGMWDDERCGKDCKSMICSYDTNFDGKLDFQEFKDMMLLTTS 164 >gb|EYU32486.1| hypothetical protein MIMGU_mgv1a015295mg [Mimulus guttatus] Length = 162 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMML 128 LGLW+E G DC+ MI +D+NSDG LDF EFK+MML Sbjct: 119 LGLWDEDCGADCEAMIAAYDSNSDGFLDFHEFKDMML 155 >ref|XP_007161420.1| hypothetical protein PHAVU_001G067400g [Phaseolus vulgaris] gi|561034884|gb|ESW33414.1| hypothetical protein PHAVU_001G067400g [Phaseolus vulgaris] Length = 156 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTIS 116 LG+W+E+ G D MI +DTN DG LDF+EFK+MMLLT S Sbjct: 116 LGMWDERCGKDSTTMICSYDTNFDGKLDFQEFKDMMLLTTS 156 >ref|XP_003589594.1| Calmodulin-like protein [Medicago truncatula] gi|355478642|gb|AES59845.1| Calmodulin-like protein [Medicago truncatula] Length = 167 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 238 LGLWEEKSGGDCKRMILEFDTNSDGVLDFKEFKNMMLLTI 119 LG+W+E+ DC+ MI +D N DG LDFKEFKNMMLLT+ Sbjct: 127 LGMWDEEK--DCRSMIYSYDINLDGKLDFKEFKNMMLLTL 164