BLASTX nr result
ID: Akebia23_contig00038116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00038116 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855408.1| hypothetical protein AMTR_s00057p00152610 [A... 67 3e-09 ref|XP_002314403.2| hypothetical protein POPTR_0010s03250g [Popu... 61 1e-07 >ref|XP_006855408.1| hypothetical protein AMTR_s00057p00152610 [Amborella trichopoda] gi|548859174|gb|ERN16875.1| hypothetical protein AMTR_s00057p00152610 [Amborella trichopoda] Length = 446 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 12/75 (16%) Frame = +3 Query: 6 DAYVLPAVRKPDHILAQSLELCLENSGGYPLA------------KNFSKPALSVDTASMG 149 D P RKPD +LAQS ELCL SGGY +F++PA+SVD MG Sbjct: 353 DLCAFPVTRKPDQLLAQSSELCLGLSGGYSSVMGAFPGQLQDNNNDFARPAMSVDANPMG 412 Query: 150 VMRNKYLQTAYLFPG 194 +MR +Y+ T Y FPG Sbjct: 413 IMRTRYISTPYSFPG 427 >ref|XP_002314403.2| hypothetical protein POPTR_0010s03250g [Populus trichocarpa] gi|550329003|gb|EEF00574.2| hypothetical protein POPTR_0010s03250g [Populus trichocarpa] Length = 392 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/63 (50%), Positives = 40/63 (63%), Gaps = 5/63 (7%) Frame = +3 Query: 21 PAVRKPDHILAQSLELCLENSGGYPLAKNFSKPA-----LSVDTASMGVMRNKYLQTAYL 185 P+V +PD ILAQS E+CL NSGG P NFS + L TAS+G++R+KYL Y Sbjct: 311 PSVHQPDEILAQSSEMCLNNSGGCPPLTNFSNQSPVDNILRPQTASVGMLRSKYLSKPYS 370 Query: 186 FPG 194 F G Sbjct: 371 FAG 373