BLASTX nr result
ID: Akebia23_contig00037159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00037159 (506 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846090.1| hypothetical protein AMTR_s00012p00098780 [A... 65 7e-09 ref|XP_006850229.1| hypothetical protein AMTR_s02491p00007000, p... 64 3e-08 ref|XP_006844793.1| hypothetical protein AMTR_s00016p00260420 [A... 64 3e-08 >ref|XP_006846090.1| hypothetical protein AMTR_s00012p00098780 [Amborella trichopoda] gi|548848860|gb|ERN07765.1| hypothetical protein AMTR_s00012p00098780 [Amborella trichopoda] Length = 118 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +1 Query: 214 TATPLKKYVTIVRSRKEGSAC--KWTCNFGCRSEPYTGTYSRIRAHLIGLLPGQKSQGVA 387 T+TPL KY+T++ + +GS KWTCNF CR P++ +Y +RAHL+G ++S+G++ Sbjct: 50 TSTPLWKYMTVIGNYGKGSGGTKKWTCNFNCRETPFSRSYVHVRAHLLGPSFAKRSKGIS 109 Query: 388 LCP 396 CP Sbjct: 110 SCP 112 >ref|XP_006850229.1| hypothetical protein AMTR_s02491p00007000, partial [Amborella trichopoda] gi|548853846|gb|ERN11810.1| hypothetical protein AMTR_s02491p00007000, partial [Amborella trichopoda] Length = 85 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = +1 Query: 214 TATPLKKYVTIV--RSRKEGSACK-WTCNFGCRSEPYTGTYSRIRAHLIGLLPGQKSQGV 384 T+TPL +YVT V +++KEG + WT NF C YTG Y+ +RAHL+G GQ SQG+ Sbjct: 16 TSTPLWRYVTRVGEKTKKEGRGTRTWTYNFNCIEASYTGLYACVRAHLLGEFQGQMSQGI 75 Query: 385 ALC 393 A C Sbjct: 76 AKC 78 >ref|XP_006844793.1| hypothetical protein AMTR_s00016p00260420 [Amborella trichopoda] gi|548847264|gb|ERN06468.1| hypothetical protein AMTR_s00016p00260420 [Amborella trichopoda] Length = 109 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = +1 Query: 214 TATPLKKYVTIVRSRKEG--SACKWTCNFGCRSEPYTGTYSRIRAHLIGLLPGQKSQGVA 387 T TPL KYVT+V S +G W CNF CR P+ +Y+ +RAHL+G G KS+G++ Sbjct: 30 TKTPLWKYVTVVGSYTKGFRGTKTWLCNFNCREAPFARSYAHVRAHLLGQQFGHKSKGIS 89 Query: 388 LC 393 C Sbjct: 90 TC 91