BLASTX nr result
ID: Akebia23_contig00036796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00036796 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006593080.1| PREDICTED: uncharacterized protein LOC102661... 56 6e-06 >ref|XP_006593080.1| PREDICTED: uncharacterized protein LOC102661631 [Glycine max] Length = 685 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 216 PLFVSCFISGLKDDIRLDVKSRRPVTLVETIALAHLYDEKL*LTRKHNCSNFIQPNPLSF 37 P +SCFISGL D+R +V + +P++L++ ALA L +EKL N N QP PL Sbjct: 182 PFLLSCFISGLNADVRREVMTLQPISLLQATALAKLQEEKLRDRVVSNTRNLYQPKPLQP 241 Query: 36 PTGNP 22 T NP Sbjct: 242 LTPNP 246