BLASTX nr result
ID: Akebia23_contig00036507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00036507 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fio... 78 1e-12 ref|XP_389072.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Fusari... 78 1e-12 gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W10... 78 1e-12 emb|CCG81315.1| 40S ribosomal protein S9 [Taphrina deformans PYC... 78 1e-12 gb|EPS36858.1| hypothetical protein H072_9617 [Dactylellina hapt... 78 1e-12 gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Tognin... 78 1e-12 gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa... 78 1e-12 gb|EMF08137.1| 40S ribosomal protein S9 [Sphaerulina musiva SO2202] 78 1e-12 ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeos... 78 1e-12 emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higgins... 78 1e-12 gb|EHK42959.1| hypothetical protein TRIATDRAFT_258286 [Trichoder... 78 1e-12 gb|EHK22520.1| hypothetical protein TRIVIDRAFT_216043 [Trichoder... 78 1e-12 ref|XP_003651341.1| 40S ribosomal protein S9 [Thielavia terrestr... 78 1e-12 gb|EGU79448.1| hypothetical protein FOXB_10033 [Fusarium oxyspor... 78 1e-12 ref|XP_006964217.1| ribosomal protein S9, S4 family [Trichoderma... 78 1e-12 ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria triti... 78 1e-12 gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola ... 78 1e-12 ref|XP_003052792.1| 40S ribosomal protein S9 [Nectria haematococ... 78 1e-12 ref|XP_001222689.1| 40S ribosomal protein S9 [Chaetomium globosu... 77 2e-12 gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe o... 77 2e-12 >ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] gi|588902324|gb|EXF82658.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] Length = 192 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >ref|XP_389072.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Fusarium graminearum PH-1] gi|408392219|gb|EKJ71577.1| hypothetical protein FPSE_08216 [Fusarium pseudograminearum CS3096] gi|558864302|gb|ESU14385.1| 40S ribosomal protein S9 [Fusarium graminearum PH-1] gi|596548933|gb|EYB28641.1| hypothetical protein FG05_08896 [Fusarium graminearum] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W106-1] Length = 190 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >emb|CCG81315.1| 40S ribosomal protein S9 [Taphrina deformans PYCC 5710] Length = 194 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 127 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 164 >gb|EPS36858.1| hypothetical protein H072_9617 [Dactylellina haptotyla CBS 200.50] Length = 192 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 127 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 164 >gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Togninia minima UCRPA7] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa lata UCREL1] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >gb|EMF08137.1| 40S ribosomal protein S9 [Sphaerulina musiva SO2202] Length = 193 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|429862840|gb|ELA37447.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|530474861|gb|EQB55027.1| hypothetical protein CGLO_05076 [Colletotrichum gloeosporioides Cg-14] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higginsianum] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >gb|EHK42959.1| hypothetical protein TRIATDRAFT_258286 [Trichoderma atroviride IMI 206040] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >gb|EHK22520.1| hypothetical protein TRIVIDRAFT_216043 [Trichoderma virens Gv29-8] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >ref|XP_003651341.1| 40S ribosomal protein S9 [Thielavia terrestris NRRL 8126] gi|346998603|gb|AEO65005.1| hypothetical protein THITE_2075346 [Thielavia terrestris NRRL 8126] Length = 219 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >gb|EGU79448.1| hypothetical protein FOXB_10033 [Fusarium oxysporum Fo5176] gi|477518882|gb|ENH71082.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. cubense race 1] gi|517318890|emb|CCT69768.1| probable 40S ribosomal protein S9 (S7) [Fusarium fujikuroi IMI 58289] gi|584130388|gb|EWG39793.1| 40S ribosomal protein S9 [Fusarium verticillioides 7600] gi|587666924|gb|EWY89265.1| 40S ribosomal protein S9 [Fusarium oxysporum FOSC 3-a] gi|587692593|gb|EWZ39198.1| 40S ribosomal protein S9 [Fusarium oxysporum Fo47] gi|587712500|gb|EWZ83837.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587742292|gb|EXA40008.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. pisi HDV247] gi|590029543|gb|EXK31401.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. melonis 26406] gi|590070609|gb|EXK98133.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. raphani 54005] gi|591415616|gb|EXL50753.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591451679|gb|EXL83997.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591464035|gb|EXL95509.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591493814|gb|EXM23382.1| 40S ribosomal protein S9 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >ref|XP_006964217.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a] gi|340519635|gb|EGR49873.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a] gi|572280482|gb|ETS03579.1| ribosomal protein S4, partial [Trichoderma reesei RUT C-30] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria tritici IPO323] gi|339467586|gb|EGP82689.1| hypothetical protein MYCGRDRAFT_106533 [Zymoseptoria tritici IPO323] Length = 194 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola M1.001] gi|477525810|gb|ENH77682.1| 40s ribosomal protein [Colletotrichum orbiculare MAFF 240422] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >ref|XP_003052792.1| 40S ribosomal protein S9 [Nectria haematococca mpVI 77-13-4] gi|256733732|gb|EEU47079.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 191 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 162 >ref|XP_001222689.1| 40S ribosomal protein S9 [Chaetomium globosum CBS 148.51] gi|88182507|gb|EAQ89975.1| 40S ribosomal protein S9 [Chaetomium globosum CBS 148.51] Length = 191 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSF+VRLDSQKHIDFALTSPF Sbjct: 125 VLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe oryzae 70-15] gi|440468672|gb|ELQ37822.1| 40S ribosomal protein S9 [Magnaporthe oryzae Y34] gi|440486607|gb|ELQ66456.1| 40S ribosomal protein S9 [Magnaporthe oryzae P131] Length = 180 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF 116 VLIRQRHIRVGKQIVNVPSF+VRLDSQKHIDFALTSPF Sbjct: 114 VLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 151