BLASTX nr result
ID: Akebia23_contig00036493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00036493 (725 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273841.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 emb|CAN70049.1| hypothetical protein VITISV_013371 [Vitis vinifera] 62 2e-07 ref|XP_006447073.1| hypothetical protein CICLE_v10018352mg [Citr... 60 8e-07 >ref|XP_002273841.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Vitis vinifera] Length = 474 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 725 IYAEVGRWEDVVKLRKVMKFGGLKKIPGWSLVDGD 621 +YAE GRWEDV++LRKVMK G LKK PGWSLVD D Sbjct: 439 MYAEAGRWEDVLRLRKVMKSGNLKKTPGWSLVDSD 473 >emb|CAN70049.1| hypothetical protein VITISV_013371 [Vitis vinifera] Length = 476 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 725 IYAEVGRWEDVVKLRKVMKFGGLKKIPGWSLVDGD 621 +YAE GRWEDV++LRKVMK G LKK PGWSLVD D Sbjct: 441 MYAEAGRWEDVLRLRKVMKSGNLKKTPGWSLVDSD 475 >ref|XP_006447073.1| hypothetical protein CICLE_v10018352mg [Citrus clementina] gi|568831618|ref|XP_006470058.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Citrus sinensis] gi|557549684|gb|ESR60313.1| hypothetical protein CICLE_v10018352mg [Citrus clementina] Length = 463 Score = 60.1 bits (144), Expect = 8e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 725 IYAEVGRWEDVVKLRKVMKFGGLKKIPGWSLVDGDK 618 +YAE RWEDV +LR VMK G LKK PGWSLVDGDK Sbjct: 428 MYAEAERWEDVTRLRSVMKQGKLKKTPGWSLVDGDK 463