BLASTX nr result
ID: Akebia23_contig00034932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00034932 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003843850.1| hypothetical protein LEMA_P015010.1 [Leptosp... 79 9e-13 ref|XP_001905649.1| hypothetical protein [Podospora anserina S m... 57 4e-06 >ref|XP_003843850.1| hypothetical protein LEMA_P015010.1 [Leptosphaeria maculans JN3] gi|312220430|emb|CBY00371.1| hypothetical protein LEMA_P015010.1 [Leptosphaeria maculans JN3] Length = 277 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +3 Query: 3 NSCLLDGTSKICWLYKGVTSGEPSKTASAPDGKVCATSGVKTSGC 137 NSCLLD +KIC L+KGVTSGEP+KTASAPDGK CATSG+KTSGC Sbjct: 235 NSCLLD--TKICELFKGVTSGEPTKTASAPDGKTCATSGIKTSGC 277 >ref|XP_001905649.1| hypothetical protein [Podospora anserina S mat+] gi|170940664|emb|CAP65892.1| unnamed protein product [Podospora anserina S mat+] Length = 249 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/46 (56%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = +3 Query: 3 NSCLLDGTSKICWLYKGVTSG-EPSKTASAPDGKVCATSGVKTSGC 137 NSCLL G + CW+Y+G SG EP+K S P G CAT+ +KTSGC Sbjct: 206 NSCLLKGAA--CWIYQGNNSGKEPTKIGSGPSGTACATAAIKTSGC 249