BLASTX nr result
ID: Akebia23_contig00034890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00034890 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia scler... 75 1e-11 gb|EPE34674.1| hypothetical protein GLAREA_10368 [Glarea lozoyen... 74 2e-11 gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistrom... 74 2e-11 ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fucke... 74 2e-11 gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2... 74 3e-11 emb|CCC10009.1| predicted 40S ribosomal protein S29 [Sordaria ma... 74 3e-11 ref|XP_961514.1| 40S ribosomal protein S29 [Neurospora crassa OR... 74 3e-11 ref|XP_007289694.1| 40S ribosomal protein S29 [Marssonina brunne... 73 4e-11 gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W1... 73 5e-11 gb|EPQ65083.1| Protein component of the small (40S) ribosomal su... 73 5e-11 ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria trit... 73 5e-11 gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia... 72 1e-10 ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres... 72 1e-10 gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carri... 71 2e-10 gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphae... 71 2e-10 ref|XP_003715133.1| 30S ribosomal protein S14p/S29e [Magnaporthe... 71 2e-10 gb|EJT80508.1| 30S ribosomal protein S14p/S29e [Gaeumannomyces g... 71 2e-10 gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolari... 70 2e-10 ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosp... 70 2e-10 ref|XP_001229052.1| 40S ribosomal protein S29 [Chaetomium globos... 70 3e-10 >ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154701369|gb|EDO01108.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] Length = 56 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGLNICRQCFREKA DIGF KHR Sbjct: 22 RVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >gb|EPE34674.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] Length = 56 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGLNICRQCFREKA DIGF KHR Sbjct: 22 RVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistroma septosporum NZE10] Length = 56 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 22 RVCTHKAGLIRKYGLNICRQCFREKSSDIGFTKHR 56 >ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fuckeliana B05.10] gi|347828118|emb|CCD43815.1| similar to 40S ribosomal protein S29 [Botryotinia fuckeliana T4] Length = 56 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGLNICRQCFREKA DIGF KHR Sbjct: 22 RVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2202] Length = 56 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 22 RVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 56 >emb|CCC10009.1| predicted 40S ribosomal protein S29 [Sordaria macrospora k-hell] Length = 56 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH AGLIRKYGLNICRQCFREKA+DIGF KHR Sbjct: 22 RVCTHSAGLIRKYGLNICRQCFREKANDIGFTKHR 56 >ref|XP_961514.1| 40S ribosomal protein S29 [Neurospora crassa OR74A] gi|30316288|sp|Q9C2P2.1|RS29_NEUCR RecName: Full=40S ribosomal protein S29 gi|12718270|emb|CAC28832.1| probable ribosomal protein S29.e.A, cytosolic [Neurospora crassa] gi|28923060|gb|EAA32278.1| 40S ribosomal protein S29 [Neurospora crassa OR74A] gi|336473030|gb|EGO61190.1| hypothetical protein NEUTE1DRAFT_135165 [Neurospora tetrasperma FGSC 2508] gi|350293719|gb|EGZ74804.1| putative ribosomal protein S29.e.A, cytosolic [Neurospora tetrasperma FGSC 2509] Length = 56 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH AGLIRKYGLNICRQCFREKA+DIGF KHR Sbjct: 22 RVCTHSAGLIRKYGLNICRQCFREKANDIGFTKHR 56 >ref|XP_007289694.1| 40S ribosomal protein S29 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866814|gb|EKD19853.1| 40S ribosomal protein S29 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 130 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGLNICRQCFREKA DIGF KH+ Sbjct: 22 RVCTHKAGLIRKYGLNICRQCFREKAHDIGFVKHK 56 >gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] Length = 56 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 22 RVCTHKAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >gb|EPQ65083.1| Protein component of the small (40S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528300960|emb|CCU75163.1| 40S ribosomal protein S29 [Blumeria graminis f. sp. hordei DH14] Length = 56 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTHKAGLIRKYGL+ICRQCFREKA DIGF KHR Sbjct: 22 RVCTHKAGLIRKYGLDICRQCFREKASDIGFVKHR 56 >ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria tritici IPO323] gi|339475249|gb|EGP90341.1| hypothetical protein MYCGRDRAFT_103406 [Zymoseptoria tritici IPO323] Length = 56 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH+AGLIRKYGLNICRQCFREKA DIGF KHR Sbjct: 22 RVCTHQAGLIRKYGLNICRQCFREKAADIGFTKHR 56 >gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] Length = 56 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH+AGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 22 RVCTHQAGLIRKYGLNICRQCFREKSADIGFTKHR 56 >ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres f. teres 0-1] gi|311326818|gb|EFQ92418.1| hypothetical protein PTT_10485 [Pyrenophora teres f. teres 0-1] Length = 56 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH AGLIRKYGLNICRQCFREKA DIGF KHR Sbjct: 22 RVCTHPAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] Length = 56 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH AGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 22 RVCTHTAGLIRKYGLNICRQCFREKSQDIGFIKHR 56 >gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] Length = 56 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH AGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 22 RVCTHPAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >ref|XP_003715133.1| 30S ribosomal protein S14p/S29e [Magnaporthe oryzae 70-15] gi|544604595|sp|P0CT15.1|RS29_MAGO7 RecName: Full=40S ribosomal protein S29 gi|544604597|sp|L7IM20.1|RS29_MAGOY RecName: Full=40S ribosomal protein S29 gi|59802952|gb|AAX07680.1| 40S ribosomal protein S29-like protein [Magnaporthe grisea] gi|351647466|gb|EHA55326.1| 30S ribosomal protein S14p/S29e [Magnaporthe oryzae 70-15] gi|440475624|gb|ELQ44293.1| hypothetical protein OOU_Y34scaffold00094g84 [Magnaporthe oryzae Y34] gi|440480842|gb|ELQ61483.1| hypothetical protein OOW_P131scaffold01180g11 [Magnaporthe oryzae P131] Length = 56 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH+AGLIRKYGL+ICRQCFREKA DIGF KHR Sbjct: 22 RVCTHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 >gb|EJT80508.1| 30S ribosomal protein S14p/S29e [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 56 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH+AGLIRKYGL+ICRQCFREKA DIGF KHR Sbjct: 22 RVCTHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 >gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolaris maydis C5] gi|477586242|gb|ENI03327.1| hypothetical protein COCC4DRAFT_41909 [Bipolaris maydis ATCC 48331] gi|576917146|gb|EUC31379.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|576936494|gb|EUC49989.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|578488927|gb|EUN26365.1| hypothetical protein COCVIDRAFT_27200 [Bipolaris victoriae FI3] Length = 56 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH AGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 22 RVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] gi|312216610|emb|CBX96560.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] Length = 118 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH AGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 84 RVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 118 >ref|XP_001229052.1| 40S ribosomal protein S29 [Chaetomium globosum CBS 148.51] gi|88183133|gb|EAQ90601.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 56 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 260 RVCTHKAGLIRKYGLNICRQCFREKADDIGFKKHR 156 RVCTH+AGLIRKYGLNICRQCFREKA DIGF K+R Sbjct: 22 RVCTHQAGLIRKYGLNICRQCFREKAADIGFVKYR 56