BLASTX nr result
ID: Akebia23_contig00034787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00034787 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003848352.1| hypothetical protein MYCGRDRAFT_63646 [Zymos... 91 2e-16 gb|EME39810.1| hypothetical protein DOTSEDRAFT_74647 [Dothistrom... 87 2e-15 gb|EMC99998.1| hypothetical protein BAUCODRAFT_145325 [Baudoinia... 85 9e-15 gb|EME77817.1| hypothetical protein MYCFIDRAFT_71850 [Pseudocerc... 82 6e-14 emb|CDK28444.1| unnamed protein product [Kuraishia capsulata CBS... 78 1e-12 gb|EON68900.1| hypothetical protein W97_08158 [Coniosporium apol... 78 1e-12 ref|XP_003298857.1| hypothetical protein PTT_09685 [Pyrenophora ... 75 1e-11 emb|CCX30901.1| Similar to Heat shock protein hsp9; acc. no. P50... 74 2e-11 ref|XP_001936138.1| conserved hypothetical protein [Pyrenophora ... 74 2e-11 emb|CCX30928.1| Similar to Heat shock protein hsp9; acc. no. P50... 74 3e-11 ref|XP_503076.1| YALI0D20526p [Yarrowia lipolytica] gi|49648944|... 74 3e-11 emb|CCX31871.1| Similar to Heat shock protein hsp9; acc. no. P50... 72 6e-11 ref|XP_007580216.1| putative chaperone heat shock protein hsp12 ... 72 6e-11 ref|XP_001264017.1| heat shock protein Awh11/Hsp9, putative [Neo... 72 6e-11 ref|XP_753104.1| heat shock protein Awh11 [Aspergillus fumigatus... 72 8e-11 ref|XP_001802342.1| hypothetical protein SNOG_12108 [Phaeosphaer... 72 8e-11 gb|EOA91142.1| hypothetical protein SETTUDRAFT_166944 [Setosphae... 72 1e-10 emb|CCX30425.1| Similar to Heat shock protein hsp9; acc. no. P50... 71 2e-10 ref|XP_007581222.1| putative chaperone heat shock protein [Neofu... 71 2e-10 ref|NP_594943.1| heat shock protein Hsp9 [Schizosaccharomyces po... 71 2e-10 >ref|XP_003848352.1| hypothetical protein MYCGRDRAFT_63646 [Zymoseptoria tritici IPO323] gi|339468227|gb|EGP83328.1| hypothetical protein MYCGRDRAFT_63646 [Zymoseptoria tritici IPO323] Length = 85 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/64 (64%), Positives = 51/64 (79%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 MTDAGRK SDK S+K TPD KST+DK +++TG DKA R+++PDSQKST+QS+GDKA Sbjct: 1 MTDAGRKDLSDKISDKATPDHSKSTMDKVGDSITGTADKAGRDLVPDSQKSTTQSIGDKA 60 Query: 13 GHEK 2 EK Sbjct: 61 SREK 64 >gb|EME39810.1| hypothetical protein DOTSEDRAFT_74647 [Dothistroma septosporum NZE10] Length = 83 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/64 (64%), Positives = 50/64 (78%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 MTD+GRK SDK +KMTPDS KSTLDK E ++GA DKA+R+++PDSQKST QS+ DKA Sbjct: 1 MTDSGRKDLSDKVGDKMTPDSSKSTLDKVGEGLSGAGDKAARDLVPDSQKSTGQSLSDKA 60 Query: 13 GHEK 2 K Sbjct: 61 SRSK 64 >gb|EMC99998.1| hypothetical protein BAUCODRAFT_145325 [Baudoinia compniacensis UAMH 10762] Length = 88 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/64 (62%), Positives = 50/64 (78%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M++ RK F+DKASEKMTP+ KST+DK SE V+ DKA R++MPD QKST+QS+GDKA Sbjct: 1 MSEGARKDFTDKASEKMTPNDSKSTVDKISEGVSDTADKAQRDLMPDDQKSTTQSLGDKA 60 Query: 13 GHEK 2 EK Sbjct: 61 SREK 64 >gb|EME77817.1| hypothetical protein MYCFIDRAFT_71850 [Pseudocercospora fijiensis CIRAD86] Length = 85 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/64 (60%), Positives = 46/64 (71%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 MTDAGRK SDK +K+TPD+ KST DK + +TGA DK R+ +PDS KST QSV DKA Sbjct: 1 MTDAGRKDLSDKIGDKVTPDNSKSTPDKVGDAITGAGDKVQRDAVPDSHKSTGQSVQDKA 60 Query: 13 GHEK 2 EK Sbjct: 61 SREK 64 >emb|CDK28444.1| unnamed protein product [Kuraishia capsulata CBS 1993] Length = 116 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/64 (57%), Positives = 48/64 (75%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+D GRK F+DKASE + PDS+KS L++A E+ TGA DK +R+V+PDSQKS QS+GD Sbjct: 1 MSDLGRKNFADKASEAIKPDSEKSYLEQAKESATGAYDKIARDVVPDSQKSFGQSIGDSV 60 Query: 13 GHEK 2 K Sbjct: 61 SKGK 64 >gb|EON68900.1| hypothetical protein W97_08158 [Coniosporium apollinis CBS 100218] Length = 90 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/64 (60%), Positives = 44/64 (68%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+DAGRK F+DKASE MTPDS KST +K E T TDK +R + D KSTSQSV DKA Sbjct: 1 MSDAGRKSFTDKASEHMTPDSTKSTTEKTKEAFTDTTDKLARGMQTDDSKSTSQSVTDKA 60 Query: 13 GHEK 2 K Sbjct: 61 SRSK 64 >ref|XP_003298857.1| hypothetical protein PTT_09685 [Pyrenophora teres f. teres 0-1] gi|311327758|gb|EFQ93044.1| hypothetical protein PTT_09685 [Pyrenophora teres f. teres 0-1] Length = 97 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/58 (58%), Positives = 46/58 (79%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGD 20 M+D+ RKG ++A EKMTPDSQKST+DKASE++TGA D+ + + P+ QKST Q +GD Sbjct: 1 MSDSMRKGLGEQAQEKMTPDSQKSTMDKASESLTGAGDRIAGTMQPEGQKSTGQKLGD 58 >emb|CCX30901.1| Similar to Heat shock protein hsp9; acc. no. P50519 [Pyronema omphalodes CBS 100304] Length = 78 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/64 (56%), Positives = 47/64 (73%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+D+ RK FSD+ SEKMTPDS KST+DKA E++T D+A E+ PDS KS++Q DK+ Sbjct: 1 MSDSLRKPFSDRVSEKMTPDSSKSTIDKAKESITTTADRAVGEMQPDSSKSSTQEGFDKS 60 Query: 13 GHEK 2 EK Sbjct: 61 RREK 64 >ref|XP_001936138.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983237|gb|EDU48725.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 97 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/58 (58%), Positives = 45/58 (77%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGD 20 M+D+ RKG ++A EK+TPDSQKST+DKASE++TGA D+ + V P+ QKS Q VGD Sbjct: 1 MSDSMRKGLGEQAQEKITPDSQKSTMDKASESLTGAGDRVAGAVQPEGQKSAGQKVGD 58 >emb|CCX30928.1| Similar to Heat shock protein hsp9; acc. no. P50519 [Pyronema omphalodes CBS 100304] gi|549051141|emb|CCX30929.1| Similar to Heat shock protein hsp9; acc. no. P50519 [Pyronema omphalodes CBS 100304] Length = 78 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/64 (56%), Positives = 46/64 (71%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+D+ RK FSD+ SEKMTPDS KST+DKA E +T D+A E+ PDS KS++Q DK+ Sbjct: 1 MSDSLRKPFSDRVSEKMTPDSSKSTIDKAKENITTTADRAVGEMQPDSSKSSTQEGFDKS 60 Query: 13 GHEK 2 EK Sbjct: 61 RREK 64 >ref|XP_503076.1| YALI0D20526p [Yarrowia lipolytica] gi|49648944|emb|CAG81268.1| YALI0D20526p [Yarrowia lipolytica CLIB122] Length = 129 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/59 (62%), Positives = 44/59 (74%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDK 17 M+ AGRK F+DK SE +TPDSQKST +K SE T A DK + V P+SQKST+Q VGDK Sbjct: 1 MSQAGRKDFTDKLSEGVTPDSQKSTGEKLSEKATDAYDKVANAVEPESQKSTTQKVGDK 59 >emb|CCX31871.1| Similar to Heat shock protein hsp9; acc. no. P50519 [Pyronema omphalodes CBS 100304] Length = 78 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/64 (56%), Positives = 45/64 (70%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+D+ RK FSD EKMTPDS KST+DKA E +T D+A E+ PDS KS++Q DK+ Sbjct: 1 MSDSLRKPFSDCVFEKMTPDSSKSTIDKAKENITTTADRAVGEMQPDSSKSSTQEGFDKS 60 Query: 13 GHEK 2 HEK Sbjct: 61 RHEK 64 >ref|XP_007580216.1| putative chaperone heat shock protein hsp12 protein [Neofusicoccum parvum UCRNP2] gi|485928653|gb|EOD52325.1| putative chaperone heat shock protein hsp12 protein [Neofusicoccum parvum UCRNP2] Length = 99 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGD 20 M+DAGRKG D+A EK+TPDSQKSTLD+A E++TG D+A+ P KSTSQ D Sbjct: 1 MSDAGRKGVLDQAQEKITPDSQKSTLDQAKESITGTYDRAAGAAQPSDTKSTSQKAAD 58 >ref|XP_001264017.1| heat shock protein Awh11/Hsp9, putative [Neosartorya fischeri NRRL 181] gi|119412179|gb|EAW22120.1| heat shock protein Awh11/Hsp9, putative [Neosartorya fischeri NRRL 181] Length = 89 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+D GRK FS KA EKMTPDSQKST+DK ETVT ATD+ + D+QKS SQ D Sbjct: 1 MSDTGRKDFSTKAQEKMTPDSQKSTMDKMKETVTDATDRLTGSAQGDNQKSYSQQAYDSV 60 Query: 13 GHE 5 E Sbjct: 61 RGE 63 >ref|XP_753104.1| heat shock protein Awh11 [Aspergillus fumigatus Af293] gi|66850739|gb|EAL91066.1| heat shock protein Awh11, putative [Aspergillus fumigatus Af293] gi|159131839|gb|EDP56952.1| heat shock protein Awh11/Hsp9, putative [Aspergillus fumigatus A1163] Length = 81 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/58 (62%), Positives = 41/58 (70%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGD 20 M+D GRK F+ KA EKMTPDSQKST+DK ETVT ATD+ + DSQKS SQ D Sbjct: 1 MSDTGRKDFTTKAQEKMTPDSQKSTMDKMKETVTDATDRLTGSAQGDSQKSYSQQAYD 58 >ref|XP_001802342.1| hypothetical protein SNOG_12108 [Phaeosphaeria nodorum SN15] gi|111059400|gb|EAT80520.1| hypothetical protein SNOG_12108 [Phaeosphaeria nodorum SN15] Length = 95 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/64 (56%), Positives = 41/64 (64%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M++A RK F KA EKMTPDS KS+ KA E VTG DK +R PD KST+Q V DK Sbjct: 1 MSEAFRKDFHTKAGEKMTPDSSKSSFQKAKEGVTGGADKIARGAQPDHSKSTTQEVSDKF 60 Query: 13 GHEK 2 G K Sbjct: 61 GRSK 64 >gb|EOA91142.1| hypothetical protein SETTUDRAFT_166944 [Setosphaeria turcica Et28A] Length = 99 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/58 (56%), Positives = 44/58 (75%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGD 20 M+D+ RKG ++ASEK+TPDSQKST +KASE +TGA D+ + + PD QKS Q +GD Sbjct: 1 MSDSMRKGLGEQASEKITPDSQKSTTEKASENLTGAGDRIAGSLQPDDQKSAGQKLGD 58 >emb|CCX30425.1| Similar to Heat shock protein hsp9; acc. no. P50519 [Pyronema omphalodes CBS 100304] Length = 79 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/64 (54%), Positives = 46/64 (71%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+D+ RK FSD+ EK+TPDS KST+DKA E VT A D+ + E+ PDS KS++Q DK+ Sbjct: 1 MSDSLRKPFSDRVEEKITPDSSKSTVDKAKENVTTAADRFAGEMQPDSSKSSTQEGFDKS 60 Query: 13 GHEK 2 EK Sbjct: 61 RREK 64 >ref|XP_007581222.1| putative chaperone heat shock protein [Neofusicoccum parvum UCRNP2] gi|485927181|gb|EOD51263.1| putative chaperone heat shock protein [Neofusicoccum parvum UCRNP2] Length = 89 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/64 (54%), Positives = 40/64 (62%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 MTDAGRK FS KA E++TPDS KST K E +T DK +R V D KST+Q DK Sbjct: 1 MTDAGRKDFSTKAKEELTPDSTKSTQQKTKEAITDTGDKFARGVQTDESKSTTQEASDKL 60 Query: 13 GHEK 2 G K Sbjct: 61 GRSK 64 >ref|NP_594943.1| heat shock protein Hsp9 [Schizosaccharomyces pombe 972h-] gi|1708321|sp|P50519.1|HSP9_SCHPO RecName: Full=Heat shock protein hsp9 gi|1136499|gb|AAB08436.1| Hsp9p [Schizosaccharomyces pombe] gi|5834789|emb|CAB55171.1| heat shock protein Hsp9 [Schizosaccharomyces pombe] Length = 68 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = -1 Query: 193 MTDAGRKGFSDKASEKMTPDSQKSTLDKASETVTGATDKASREVMPDSQKSTSQSVGDKA 14 M+D RK F+++ EKMTPDS KSTLDKA E++TGA DK + D KSTSQ DKA Sbjct: 1 MSDPARKSFTEQGKEKMTPDSSKSTLDKAKESITGAYDKVASAFTSDEDKSTSQEAHDKA 60