BLASTX nr result
ID: Akebia23_contig00034522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00034522 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007215778.1| hypothetical protein PRUPE_ppa009667mg [Prun... 57 3e-06 >ref|XP_007215778.1| hypothetical protein PRUPE_ppa009667mg [Prunus persica] gi|462411928|gb|EMJ16977.1| hypothetical protein PRUPE_ppa009667mg [Prunus persica] Length = 282 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 408 EGEREGYAWLEEMEKPEDFIVDVPKYRGPKIVE 310 E E+EGYAWL+E+EKPED VD KYRGPKIVE Sbjct: 249 EEEKEGYAWLQEIEKPEDLAVDGAKYRGPKIVE 281