BLASTX nr result
ID: Akebia23_contig00033788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033788 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29654.1| hypothetical protein MIMGU_mgv1a025784mg [Mimulus... 74 2e-11 ref|XP_002522140.1| conserved hypothetical protein [Ricinus comm... 73 4e-11 ref|XP_002528598.1| conserved hypothetical protein [Ricinus comm... 73 5e-11 ref|XP_007217420.1| hypothetical protein PRUPE_ppa026411mg [Prun... 72 6e-11 ref|NP_181184.1| uncharacterized protein [Arabidopsis thaliana] ... 72 1e-10 ref|XP_006410820.1| hypothetical protein EUTSA_v10016644mg [Eutr... 71 1e-10 ref|XP_002522141.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 gb|EXB37757.1| hypothetical protein L484_013795 [Morus notabilis] 71 2e-10 ref|XP_007041076.1| Uncharacterized protein TCM_006050 [Theobrom... 69 5e-10 ref|XP_004501312.1| PREDICTED: UPF0481 protein At3g47200-like [C... 69 7e-10 ref|XP_007221717.1| hypothetical protein PRUPE_ppb014831mg [Prun... 69 7e-10 ref|XP_004253152.1| PREDICTED: UPF0481 protein At3g47200-like [S... 69 9e-10 ref|XP_006294200.1| hypothetical protein CARUB_v10023196mg [Caps... 68 1e-09 ref|XP_002879612.1| hypothetical protein ARALYDRAFT_902761 [Arab... 68 1e-09 ref|XP_007198887.1| hypothetical protein PRUPE_ppa024518mg, part... 68 2e-09 ref|XP_002522138.1| conserved hypothetical protein [Ricinus comm... 68 2e-09 gb|EXC31344.1| hypothetical protein L484_017624 [Morus notabilis] 67 2e-09 ref|XP_007202944.1| hypothetical protein PRUPE_ppa016383mg [Prun... 67 3e-09 ref|XP_007198960.1| hypothetical protein PRUPE_ppa024676mg, part... 67 3e-09 ref|XP_007198889.1| hypothetical protein PRUPE_ppa020897mg, part... 67 3e-09 >gb|EYU29654.1| hypothetical protein MIMGU_mgv1a025784mg [Mimulus guttatus] Length = 433 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/79 (49%), Positives = 56/79 (70%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EMML+DGCFI+ELF + A++ L +DI ++ ++ +L D IL ENQ+PFF+LE Sbjct: 138 FVEMMLIDGCFIIELFLEFAFKSL--RRRDDICFGTNDVIFKLRCDLILFENQVPFFVLE 195 Query: 183 RLFNLTRVSKEGNRSLNEL 239 +LF+L + KE N SL EL Sbjct: 196 KLFHLVPIPKECNMSLVEL 214 >ref|XP_002522140.1| conserved hypothetical protein [Ricinus communis] gi|223538739|gb|EEF40340.1| conserved hypothetical protein [Ricinus communis] Length = 417 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/76 (46%), Positives = 52/76 (68%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EM+++DGCFI+ELF + + +V + +D W+ LV D +LLENQLP+F+L+ Sbjct: 118 FVEMLVIDGCFIIELF--RRFLKIVPTSADDPLFKMPWVRKVLVTDLLLLENQLPWFVLD 175 Query: 183 RLFNLTRVSKEGNRSL 230 RLFNLT+ + RSL Sbjct: 176 RLFNLTKSDNDSERSL 191 >ref|XP_002528598.1| conserved hypothetical protein [Ricinus communis] gi|223531994|gb|EEF33806.1| conserved hypothetical protein [Ricinus communis] Length = 489 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/71 (53%), Positives = 52/71 (73%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EMM+LDGCFI+ELF K A V VE ++ IF++ W++ D + LENQ+PFFILE Sbjct: 176 FVEMMVLDGCFIIELFRKVADVVQVEADD-PIFTMQ-WIITFFYRDLLRLENQIPFFILE 233 Query: 183 RLFNLTRVSKE 215 RLF+L+R+ E Sbjct: 234 RLFDLSRIPGE 244 >ref|XP_007217420.1| hypothetical protein PRUPE_ppa026411mg [Prunus persica] gi|462413570|gb|EMJ18619.1| hypothetical protein PRUPE_ppa026411mg [Prunus persica] Length = 457 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/66 (54%), Positives = 52/66 (78%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F++MM+LDGCF+LELF K+ ++ L + N+ +F+LS M+ L D +LLENQLP+F+LE Sbjct: 133 FVQMMILDGCFLLELFRKELWDYLQDEND-PVFNLSC-MLEYLYHDLLLLENQLPWFVLE 190 Query: 183 RLFNLT 200 RL+NLT Sbjct: 191 RLYNLT 196 >ref|NP_181184.1| uncharacterized protein [Arabidopsis thaliana] gi|4581143|gb|AAD24627.1| hypothetical protein [Arabidopsis thaliana] gi|18377795|gb|AAL67047.1| unknown protein [Arabidopsis thaliana] gi|21280851|gb|AAM45097.1| unknown protein [Arabidopsis thaliana] gi|330254159|gb|AEC09253.1| uncharacterized protein AT2G36430 [Arabidopsis thaliana] Length = 448 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/81 (50%), Positives = 49/81 (60%), Gaps = 2/81 (2%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F EMM+LDGCF+LELF K LV ND +W++ DF+ LENQ+PFF+LE Sbjct: 131 FNEMMVLDGCFLLELFRK--VNNLVPFEPNDPLVAMAWVLPFFYRDFLCLENQIPFFVLE 188 Query: 183 RLFNLTRVSKEG--NRSLNEL 239 LFNLTR E N SL L Sbjct: 189 TLFNLTRGDNENETNASLQSL 209 >ref|XP_006410820.1| hypothetical protein EUTSA_v10016644mg [Eutrema salsugineum] gi|557111989|gb|ESQ52273.1| hypothetical protein EUTSA_v10016644mg [Eutrema salsugineum] Length = 454 Score = 71.2 bits (173), Expect = 1e-10 Identities = 42/81 (51%), Positives = 52/81 (64%), Gaps = 2/81 (2%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F EMM+LDGCFILELF K + LV ++D SW++ DFI +ENQ+PFF+LE Sbjct: 137 FNEMMVLDGCFILELFRKVSK--LVPFEQDDPLVAMSWVLPFFYRDFIRIENQIPFFVLE 194 Query: 183 RLFNLTR--VSKEGNRSLNEL 239 LF+LTR KE N SL L Sbjct: 195 SLFDLTRGDNEKETNASLPSL 215 >ref|XP_002522141.1| conserved hypothetical protein [Ricinus communis] gi|223538740|gb|EEF40341.1| conserved hypothetical protein [Ricinus communis] Length = 415 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/79 (44%), Positives = 54/79 (68%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F EM+++DGCFI+ELF + + +V+ +++ +F + W+ LV D +LLENQLP+F+L Sbjct: 118 FAEMLIIDGCFIIELF--RRFVCIVQKDDDPLFKMP-WVRKVLVTDLLLLENQLPWFVLN 174 Query: 183 RLFNLTRVSKEGNRSLNEL 239 RLF L+ RSLN+L Sbjct: 175 RLFELSDTYDSEGRSLNQL 193 >gb|EXB37757.1| hypothetical protein L484_013795 [Morus notabilis] Length = 460 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/71 (47%), Positives = 48/71 (67%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EMM+LDGCF++ELF K A LV +D +W++ DF+ LENQ+PFF+LE Sbjct: 144 FVEMMVLDGCFVIELFRKAAN--LVRFESDDPILTMAWIIPFFYRDFLRLENQIPFFVLE 201 Query: 183 RLFNLTRVSKE 215 +LF+LT+ E Sbjct: 202 KLFSLTKSPAE 212 >ref|XP_007041076.1| Uncharacterized protein TCM_006050 [Theobroma cacao] gi|508705011|gb|EOX96907.1| Uncharacterized protein TCM_006050 [Theobroma cacao] Length = 579 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/79 (48%), Positives = 50/79 (63%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F++MML+DGCFI+ELF + L + N + WM+ L D I+LENQLP F+L+ Sbjct: 173 FVKMMLVDGCFIVELFRE-----LKQNNFRHARPVKRWMLPTLRRDLIMLENQLPLFVLQ 227 Query: 183 RLFNLTRVSKEGNRSLNEL 239 LF+LTR S E SL EL Sbjct: 228 TLFDLTRRSGESTTSLGEL 246 >ref|XP_004501312.1| PREDICTED: UPF0481 protein At3g47200-like [Cicer arietinum] Length = 429 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/74 (40%), Positives = 52/74 (70%) Frame = +3 Query: 6 IEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILER 185 ++++L+D FI+ELF++ Y+ + +++D F L W+ + + +D +LLENQLPFF+LE Sbjct: 112 VKLILIDSGFIIELFWRSFYD---DWSQDDAFLLKPWLASNIRLDLLLLENQLPFFVLEN 168 Query: 186 LFNLTRVSKEGNRS 227 +FNL+ VS N + Sbjct: 169 IFNLSNVSANINNN 182 >ref|XP_007221717.1| hypothetical protein PRUPE_ppb014831mg [Prunus persica] gi|462418653|gb|EMJ22916.1| hypothetical protein PRUPE_ppb014831mg [Prunus persica] Length = 484 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/67 (53%), Positives = 49/67 (73%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 FIEMM+LDGCFI+E F Y+ ++N+ IF++ M+ L D +LLENQLP+F+LE Sbjct: 143 FIEMMILDGCFIMEFFRNFYYKERRDIND-PIFNMDC-MIQYLFHDLLLLENQLPWFVLE 200 Query: 183 RLFNLTR 203 RL+NLTR Sbjct: 201 RLYNLTR 207 >ref|XP_004253152.1| PREDICTED: UPF0481 protein At3g47200-like [Solanum lycopersicum] Length = 418 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/79 (46%), Positives = 51/79 (64%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F++MMLLD CF++ELF K + + +DI ++ M RL D ILLENQ+PFFIL Sbjct: 135 FVQMMLLDSCFLIELFIK--FVIKGFRRRDDILFINYDMFFRLRCDLILLENQIPFFILH 192 Query: 183 RLFNLTRVSKEGNRSLNEL 239 ++FNL + KE SL +L Sbjct: 193 QMFNLVPIPKECTYSLMQL 211 >ref|XP_006294200.1| hypothetical protein CARUB_v10023196mg [Capsella rubella] gi|482562908|gb|EOA27098.1| hypothetical protein CARUB_v10023196mg [Capsella rubella] Length = 451 Score = 68.2 bits (165), Expect = 1e-09 Identities = 40/81 (49%), Positives = 50/81 (61%), Gaps = 2/81 (2%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F EMM+LDGCFILELF K + +LV ND +W++ D + LENQ+PF +LE Sbjct: 135 FNEMMVLDGCFILELFRKVS--ILVPSEPNDPLMAMAWVLPFSYRDLLRLENQIPFLVLE 192 Query: 183 RLFNLTR--VSKEGNRSLNEL 239 LF+LTR KE N SL L Sbjct: 193 TLFDLTRGDNEKETNASLQSL 213 >ref|XP_002879612.1| hypothetical protein ARALYDRAFT_902761 [Arabidopsis lyrata subsp. lyrata] gi|297325451|gb|EFH55871.1| hypothetical protein ARALYDRAFT_902761 [Arabidopsis lyrata subsp. lyrata] Length = 451 Score = 68.2 bits (165), Expect = 1e-09 Identities = 40/81 (49%), Positives = 49/81 (60%), Gaps = 2/81 (2%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F EMM+LDGCF+LELF K LV ND +W++ DF+ LENQ+PFF+LE Sbjct: 134 FNEMMVLDGCFLLELFRK--VNNLVPFEPNDPLVAMAWVLPFFYRDFLCLENQIPFFVLE 191 Query: 183 RLFNLTR--VSKEGNRSLNEL 239 LF+LTR E N SL L Sbjct: 192 TLFDLTRGDNKNETNASLPSL 212 >ref|XP_007198887.1| hypothetical protein PRUPE_ppa024518mg, partial [Prunus persica] gi|462394182|gb|EMJ00086.1| hypothetical protein PRUPE_ppa024518mg, partial [Prunus persica] Length = 408 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/66 (53%), Positives = 50/66 (75%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EMM++DGCFI+E F + A EV V+ NE+ +FS +SWM ++ D +LLENQLP+ +L+ Sbjct: 128 FLEMMVIDGCFIIEFFRRFANEVTVD-NEDGLFS-TSWMPLAVINDLLLLENQLPWRVLD 185 Query: 183 RLFNLT 200 LF LT Sbjct: 186 CLFELT 191 >ref|XP_002522138.1| conserved hypothetical protein [Ricinus communis] gi|223538737|gb|EEF40338.1| conserved hypothetical protein [Ricinus communis] Length = 417 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/75 (42%), Positives = 50/75 (66%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EM+++DGCFI+ELF + + +V + +D W+ LV D +LLENQLP+F+L+ Sbjct: 118 FVEMLVIDGCFIIELF--RRFVKIVPTSADDPLFKMPWVRKVLVTDLLLLENQLPWFVLD 175 Query: 183 RLFNLTRVSKEGNRS 227 LFNLT+ + R+ Sbjct: 176 CLFNLTKSDNDSERT 190 >gb|EXC31344.1| hypothetical protein L484_017624 [Morus notabilis] Length = 440 Score = 67.4 bits (163), Expect = 2e-09 Identities = 39/70 (55%), Positives = 51/70 (72%), Gaps = 1/70 (1%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNEND-IFSLSSWMVNRLVVDFILLENQLPFFIL 179 F+E+++LDGCFI+ELF KK Y+ L END IFS+S ++ L D ILLENQ+P+ +L Sbjct: 132 FVEVLVLDGCFIIELFRKKEYKSL--KGENDPIFSMSC-LLQFLSHDLILLENQIPWMVL 188 Query: 180 ERLFNLTRVS 209 E LFNLT S Sbjct: 189 EILFNLTITS 198 >ref|XP_007202944.1| hypothetical protein PRUPE_ppa016383mg [Prunus persica] gi|462398475|gb|EMJ04143.1| hypothetical protein PRUPE_ppa016383mg [Prunus persica] Length = 426 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/71 (49%), Positives = 48/71 (67%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EMM++DGCFI+ELF K Y +V N++D + WM L+ D LLENQLP+ +LE Sbjct: 121 FVEMMVVDGCFIIELFRK--YARVVPSNKDDPVFYTLWMHTALINDLFLLENQLPWRVLE 178 Query: 183 RLFNLTRVSKE 215 LF+ TR + E Sbjct: 179 CLFHNTRENNE 189 >ref|XP_007198960.1| hypothetical protein PRUPE_ppa024676mg, partial [Prunus persica] gi|462394255|gb|EMJ00159.1| hypothetical protein PRUPE_ppa024676mg, partial [Prunus persica] Length = 507 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/66 (53%), Positives = 50/66 (75%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EMM++DGCFI E F + A EV V+ NE+ +FS +SWM+ ++ D +LLENQLP+ +L+ Sbjct: 260 FLEMMVIDGCFISEFFLRFANEVNVD-NEDGLFS-TSWMLLAVINDLLLLENQLPWRVLD 317 Query: 183 RLFNLT 200 LF LT Sbjct: 318 CLFELT 323 >ref|XP_007198889.1| hypothetical protein PRUPE_ppa020897mg, partial [Prunus persica] gi|462394184|gb|EMJ00088.1| hypothetical protein PRUPE_ppa020897mg, partial [Prunus persica] Length = 443 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/66 (53%), Positives = 50/66 (75%) Frame = +3 Query: 3 FIEMMLLDGCFILELFYKKAYEVLVEMNENDIFSLSSWMVNRLVVDFILLENQLPFFILE 182 F+EMM++DGCFI E F + A EV V+ NE+ +FS +SWM+ ++ D +LLENQLP+ +L+ Sbjct: 196 FLEMMVIDGCFISEFFLRFANEVNVD-NEDGLFS-TSWMLLAVINDLLLLENQLPWRVLD 253 Query: 183 RLFNLT 200 LF LT Sbjct: 254 CLFELT 259