BLASTX nr result
ID: Akebia23_contig00032084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00032084 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33909.1| 5'-3' exoribonuclease [Cucumis melo subsp. melo] 87 3e-15 ref|XP_006826276.1| hypothetical protein AMTR_s00004p00046450 [A... 86 7e-15 ref|XP_007208373.1| hypothetical protein PRUPE_ppa000881mg [Prun... 84 2e-14 gb|EXB39214.1| 5'-3' exoribonuclease 4 [Morus notabilis] 84 3e-14 ref|XP_004172506.1| PREDICTED: 5'-3' exoribonuclease 4-like, par... 82 1e-13 ref|XP_004139217.1| PREDICTED: 5'-3' exoribonuclease 4-like [Cuc... 82 1e-13 ref|XP_006606481.1| PREDICTED: 5'-3' exoribonuclease 4-like isof... 80 2e-13 ref|XP_006606479.1| PREDICTED: 5'-3' exoribonuclease 4-like isof... 80 2e-13 ref|XP_006606480.1| PREDICTED: 5'-3' exoribonuclease 4-like isof... 80 2e-13 ref|XP_002512252.1| 5'->3' exoribonuclease, putative [Ricinus co... 80 2e-13 ref|XP_006382752.1| 5'-3' exoribonuclease family protein [Populu... 80 4e-13 ref|XP_006301240.1| hypothetical protein CARUB_v10021640mg [Caps... 79 5e-13 ref|XP_004302012.1| PREDICTED: 5'-3' exoribonuclease 4-like [Fra... 79 6e-13 ref|XP_006389319.1| 5'-3' exoribonuclease family protein [Populu... 78 1e-12 ref|NP_175851.1| 5'-3' exoribonuclease 4 [Arabidopsis thaliana] ... 78 1e-12 gb|AAD25627.1|AC005287_29 Dhm1- and Dhm2-like protein [Arabidops... 78 1e-12 gb|EYU37061.1| hypothetical protein MIMGU_mgv1a002926mg [Mimulus... 77 2e-12 ref|XP_007144805.1| hypothetical protein PHAVU_007G185300g [Phas... 77 3e-12 ref|XP_007030645.1| Exoribonuclease 4 isoform 1 [Theobroma cacao... 75 7e-12 ref|XP_006433057.1| hypothetical protein CICLE_v10000168mg [Citr... 74 3e-11 >gb|ADN33909.1| 5'-3' exoribonuclease [Cucumis melo subsp. melo] Length = 934 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY SI+DV+EEEP +GPNG +LPID SKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPRSIADVVEEEPLDGPNGVLLPIDVSKPNPNGMEF 49 >ref|XP_006826276.1| hypothetical protein AMTR_s00004p00046450 [Amborella trichopoda] gi|548830590|gb|ERM93513.1| hypothetical protein AMTR_s00004p00046450 [Amborella trichopoda] Length = 936 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY L I DVIEEEP EG NG +LP+D SKPNPNN EF Sbjct: 1 MGVPAFYRWLADRYPLCIVDVIEEEPVEGDNGVLLPVDVSKPNPNNTEF 49 >ref|XP_007208373.1| hypothetical protein PRUPE_ppa000881mg [Prunus persica] gi|462404015|gb|EMJ09572.1| hypothetical protein PRUPE_ppa000881mg [Prunus persica] Length = 972 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSI DV+EE+P EGPNG LPID S+PNPN EF Sbjct: 1 MGVPAFYRWLADRYPLSIVDVVEEQPREGPNGVPLPIDVSRPNPNGYEF 49 >gb|EXB39214.1| 5'-3' exoribonuclease 4 [Morus notabilis] Length = 957 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSISDV+EEEP E NG +PID SKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPLSISDVVEEEPKEDSNGIPMPIDVSKPNPNGLEF 49 >ref|XP_004172506.1| PREDICTED: 5'-3' exoribonuclease 4-like, partial [Cucumis sativus] Length = 254 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY SI+DV+EEEP GP+G + PID SKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPRSIADVVEEEPVGGPSGVLFPIDVSKPNPNGMEF 49 >ref|XP_004139217.1| PREDICTED: 5'-3' exoribonuclease 4-like [Cucumis sativus] Length = 934 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY SI+DV+EEEP GP+G + PID SKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPRSIADVVEEEPVGGPSGVLFPIDVSKPNPNGMEF 49 >ref|XP_006606481.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X3 [Glycine max] Length = 907 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSI+DV+EE+P+ G +G PIDASKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPLSIADVVEEDPAVGDDGVPFPIDASKPNPNGMEF 49 >ref|XP_006606479.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Glycine max] Length = 932 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSI+DV+EE+P+ G +G PIDASKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPLSIADVVEEDPAVGDDGVPFPIDASKPNPNGMEF 49 >ref|XP_006606480.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Glycine max] Length = 931 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSI+DV+EE+P+ G +G PIDASKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPLSIADVVEEDPAVGDDGVPFPIDASKPNPNGMEF 49 >ref|XP_002512252.1| 5'->3' exoribonuclease, putative [Ricinus communis] gi|223548213|gb|EEF49704.1| 5'->3' exoribonuclease, putative [Ricinus communis] Length = 964 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY L+I DV+EEEP E NG I PID SKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPLAIVDVVEEEPKEDSNGVIGPIDISKPNPNGLEF 49 >ref|XP_006382752.1| 5'-3' exoribonuclease family protein [Populus trichocarpa] gi|550338119|gb|ERP60549.1| 5'-3' exoribonuclease family protein [Populus trichocarpa] Length = 948 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSI DVIEEEP E NG PID SKPNPN IE+ Sbjct: 1 MGVPAFYRWLADRYPLSIVDVIEEEPQEDSNGNSKPIDVSKPNPNGIEY 49 >ref|XP_006301240.1| hypothetical protein CARUB_v10021640mg [Capsella rubella] gi|482569950|gb|EOA34138.1| hypothetical protein CARUB_v10021640mg [Capsella rubella] Length = 948 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY SISDV+EEEP++G G ++P+D +KPNPN EF Sbjct: 1 MGVPAFYRWLADRYPKSISDVVEEEPTDGGRGDLIPVDITKPNPNGFEF 49 >ref|XP_004302012.1| PREDICTED: 5'-3' exoribonuclease 4-like [Fragaria vesca subsp. vesca] Length = 971 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSI DV+EE P E PNG PID S+PNPN EF Sbjct: 1 MGVPAFYRWLADRYPLSIVDVVEEHPREDPNGVPRPIDVSRPNPNGFEF 49 >ref|XP_006389319.1| 5'-3' exoribonuclease family protein [Populus trichocarpa] gi|550312079|gb|ERP48233.1| 5'-3' exoribonuclease family protein [Populus trichocarpa] Length = 965 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/49 (77%), Positives = 38/49 (77%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYR L DRY LSISDVIEEEP E NG PID SKPNPN IEF Sbjct: 1 MGVPAFYRLLADRYPLSISDVIEEEPQEDSNGNSKPIDVSKPNPNGIEF 49 >ref|NP_175851.1| 5'-3' exoribonuclease 4 [Arabidopsis thaliana] gi|75262833|sp|Q9FQ04.1|XRN4_ARATH RecName: Full=5'-3' exoribonuclease 4; AltName: Full=Protein ACC INSENSITIVE 1; AltName: Full=Protein ETHYLENE INSENSITIVE 5; AltName: Full=Protein EXORIBONUCLEASE 4 gi|11875626|gb|AAG40731.1|AF286718_1 XRN4 [Arabidopsis thaliana] gi|17381112|gb|AAL36368.1| putative exonuclease [Arabidopsis thaliana] gi|20259665|gb|AAM14350.1| putative exonuclease [Arabidopsis thaliana] gi|109627646|gb|ABG34298.1| At1g54490 [Arabidopsis thaliana] gi|332194988|gb|AEE33109.1| 5'-3' exoribonuclease 4 [Arabidopsis thaliana] Length = 947 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY SISDV+EEEP++G G ++P+D ++PNPN EF Sbjct: 1 MGVPAFYRWLADRYPKSISDVVEEEPTDGGRGDLIPVDITRPNPNGFEF 49 >gb|AAD25627.1|AC005287_29 Dhm1- and Dhm2-like protein [Arabidopsis thaliana] Length = 965 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY SISDV+EEEP++G G ++P+D ++PNPN EF Sbjct: 1 MGVPAFYRWLADRYPKSISDVVEEEPTDGGRGDLIPVDITRPNPNGFEF 49 >gb|EYU37061.1| hypothetical protein MIMGU_mgv1a002926mg [Mimulus guttatus] Length = 423 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY I DV+EEEP NGA LP+D S+PNPN IEF Sbjct: 1 MGVPAFYRWLADRYPKCIVDVVEEEPRNAANGAPLPVDVSRPNPNGIEF 49 >ref|XP_007144805.1| hypothetical protein PHAVU_007G185300g [Phaseolus vulgaris] gi|561017995|gb|ESW16799.1| hypothetical protein PHAVU_007G185300g [Phaseolus vulgaris] Length = 932 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY L I+DVIE+EP+ G +G LPIDASKPN N +EF Sbjct: 1 MGVPAFYRWLADRYPLCIADVIEDEPAVGDDGVPLPIDASKPNLNGMEF 49 >ref|XP_007030645.1| Exoribonuclease 4 isoform 1 [Theobroma cacao] gi|508719250|gb|EOY11147.1| Exoribonuclease 4 isoform 1 [Theobroma cacao] Length = 990 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY SI+DVIEEEP E G +P+D SKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPQSIADVIEEEPREDGLGNQIPVDVSKPNPNGLEF 49 >ref|XP_006433057.1| hypothetical protein CICLE_v10000168mg [Citrus clementina] gi|568835355|ref|XP_006471738.1| PREDICTED: 5'-3' exoribonuclease 4-like [Citrus sinensis] gi|557535179|gb|ESR46297.1| hypothetical protein CICLE_v10000168mg [Citrus clementina] Length = 959 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +2 Query: 254 MGVPAFYRWLTDRYSLSISDVIEEEPSEGPNGAILPIDASKPNPNNIEF 400 MGVPAFYRWL DRY LSI DV+EE+P G P+D SKPNPN +EF Sbjct: 1 MGVPAFYRWLADRYPLSIVDVVEEDPQVDGEGVARPVDVSKPNPNGMEF 49