BLASTX nr result
ID: Akebia23_contig00030347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00030347 (151 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004251806.1| PREDICTED: F-box protein ORE9-like [Solanum ... 66 6e-09 ref|XP_006350026.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-l... 65 8e-09 ref|XP_006348874.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-l... 65 1e-08 gb|AFZ99010.1| F-box protein MAX2c [Chrysanthemum x morifolium] 65 1e-08 gb|AEB97385.1| MAX2B [Petunia x hybrida] 65 1e-08 gb|AEB37345.1| more axillary branches 2 [Helianthus argophyllus] 65 1e-08 gb|AEB37342.1| more axillary branches 2 [Helianthus argophyllus]... 65 1e-08 gb|AEB37340.1| more axillary branches 2 [Helianthus argophyllus]... 65 1e-08 gb|AEB37338.1| more axillary branches 2 [Helianthus argophyllus]... 65 1e-08 sp|I1SSI5.1|MAX2A_PETHY RecName: Full=F-box/LRR-repeat MAX2 homo... 64 2e-08 gb|AEB37414.1| more axillary branches 2 [Helianthus annuus] 64 2e-08 gb|AEB37411.1| more axillary branches 2 [Helianthus annuus] 64 2e-08 gb|AEB37392.1| more axillary branches 2 [Helianthus annuus] gi|3... 64 2e-08 gb|AEB37382.1| more axillary branches 2 [Helianthus annuus] gi|3... 64 2e-08 gb|AEB37376.1| more axillary branches 2 [Helianthus annuus] gi|3... 64 2e-08 gb|AEB37372.1| more axillary branches 2 [Helianthus annuus] 64 2e-08 gb|AEB37370.1| more axillary branches 2 [Helianthus annuus] gi|3... 64 2e-08 gb|AEB37366.1| more axillary branches 2 [Helianthus annuus] gi|3... 64 2e-08 gb|AEB37362.1| more axillary branches 2 [Helianthus annuus] gi|3... 64 2e-08 gb|AEB37356.1| more axillary branches 2 [Helianthus annuus] gi|3... 64 2e-08 >ref|XP_004251806.1| PREDICTED: F-box protein ORE9-like [Solanum lycopersicum] Length = 722 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSPHPSLLPQ 5 ER+TRT+L +RGNIR+L+M+P+CF SV L+LSL+SPWG HP L P+ Sbjct: 45 ERATRTSLTLRGNIRDLFMLPTCFRSVTHLDLSLVSPWG--HPLLSPR 90 >ref|XP_006350026.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Solanum tuberosum] Length = 724 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSPHPSLLPQ 5 ERSTR++L +RGNIR+L+M+P+CF SV L+LSL+SPWG HP L P+ Sbjct: 45 ERSTRSSLTLRGNIRDLFMLPTCFRSVTHLDLSLVSPWG--HPLLSPR 90 >ref|XP_006348874.1| PREDICTED: F-box/LRR-repeat MAX2 homolog A-like [Solanum tuberosum] Length = 711 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/47 (61%), Positives = 39/47 (82%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSPHPSLLP 8 ERSTR++L +RGN+R+L+M+P+CF SV L+LSL+SPWG HP L P Sbjct: 46 ERSTRSSLTLRGNVRDLFMLPTCFRSVTHLDLSLISPWG--HPLLSP 90 >gb|AFZ99010.1| F-box protein MAX2c [Chrysanthemum x morifolium] Length = 682 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 +RSTRT+L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 43 DRSTRTSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 83 >gb|AEB97385.1| MAX2B [Petunia x hybrida] Length = 723 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTRT+L +RGNIR+L+M+P+CF S+ L+LSL+SPWG P Sbjct: 46 ERSTRTSLTLRGNIRDLFMLPTCFRSITYLDLSLISPWGHP 86 >gb|AEB37345.1| more axillary branches 2 [Helianthus argophyllus] Length = 225 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 16 ERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHP 56 >gb|AEB37342.1| more axillary branches 2 [Helianthus argophyllus] gi|328691463|gb|AEB37343.1| more axillary branches 2 [Helianthus argophyllus] Length = 210 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 4 ERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHP 44 >gb|AEB37340.1| more axillary branches 2 [Helianthus argophyllus] gi|328691459|gb|AEB37341.1| more axillary branches 2 [Helianthus argophyllus] Length = 219 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 10 ERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHP 50 >gb|AEB37338.1| more axillary branches 2 [Helianthus argophyllus] gi|328691455|gb|AEB37339.1| more axillary branches 2 [Helianthus argophyllus] Length = 228 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVSHLDLSLLSPWGHP 59 >sp|I1SSI5.1|MAX2A_PETHY RecName: Full=F-box/LRR-repeat MAX2 homolog A; AltName: Full=F-box and leucine-rich repeat MAX2 homolog A gi|329739343|gb|AEB97384.1| MAX2A [Petunia x hybrida] Length = 708 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSPHPSLLP 8 ERSTR +L +RGN+R+L+M+P+CF S+ L+LSL+SPWG HP L P Sbjct: 40 ERSTRVSLTLRGNVRDLFMLPTCFRSITHLDLSLISPWG--HPLLSP 84 >gb|AEB37414.1| more axillary branches 2 [Helianthus annuus] Length = 228 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37411.1| more axillary branches 2 [Helianthus annuus] Length = 221 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37392.1| more axillary branches 2 [Helianthus annuus] gi|328691563|gb|AEB37393.1| more axillary branches 2 [Helianthus annuus] Length = 225 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37382.1| more axillary branches 2 [Helianthus annuus] gi|328691543|gb|AEB37383.1| more axillary branches 2 [Helianthus annuus] gi|328691545|gb|AEB37384.1| more axillary branches 2 [Helianthus annuus] gi|328691547|gb|AEB37385.1| more axillary branches 2 [Helianthus annuus] Length = 246 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37376.1| more axillary branches 2 [Helianthus annuus] gi|328691531|gb|AEB37377.1| more axillary branches 2 [Helianthus annuus] gi|328691533|gb|AEB37378.1| more axillary branches 2 [Helianthus annuus] gi|328691535|gb|AEB37379.1| more axillary branches 2 [Helianthus annuus] gi|328691591|gb|AEB37407.1| more axillary branches 2 [Helianthus annuus] gi|328691593|gb|AEB37408.1| more axillary branches 2 [Helianthus annuus] gi|328691601|gb|AEB37412.1| more axillary branches 2 [Helianthus annuus] Length = 221 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37372.1| more axillary branches 2 [Helianthus annuus] Length = 228 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37370.1| more axillary branches 2 [Helianthus annuus] gi|328691519|gb|AEB37371.1| more axillary branches 2 [Helianthus annuus] gi|328691549|gb|AEB37386.1| more axillary branches 2 [Helianthus annuus] gi|328691551|gb|AEB37387.1| more axillary branches 2 [Helianthus annuus] gi|328691565|gb|AEB37394.1| more axillary branches 2 [Helianthus annuus] gi|328691567|gb|AEB37395.1| more axillary branches 2 [Helianthus annuus] gi|328691569|gb|AEB37396.1| more axillary branches 2 [Helianthus annuus] gi|328691571|gb|AEB37397.1| more axillary branches 2 [Helianthus annuus] gi|328691573|gb|AEB37398.1| more axillary branches 2 [Helianthus annuus] gi|328691575|gb|AEB37399.1| more axillary branches 2 [Helianthus annuus] gi|328691581|gb|AEB37402.1| more axillary branches 2 [Helianthus annuus] gi|328691583|gb|AEB37403.1| more axillary branches 2 [Helianthus annuus] gi|328691585|gb|AEB37404.1| more axillary branches 2 [Helianthus annuus] gi|328691587|gb|AEB37405.1| more axillary branches 2 [Helianthus annuus] Length = 219 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37366.1| more axillary branches 2 [Helianthus annuus] gi|328691511|gb|AEB37367.1| more axillary branches 2 [Helianthus annuus] Length = 202 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 1 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 41 >gb|AEB37362.1| more axillary branches 2 [Helianthus annuus] gi|328691503|gb|AEB37363.1| more axillary branches 2 [Helianthus annuus] Length = 233 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59 >gb|AEB37356.1| more axillary branches 2 [Helianthus annuus] gi|328691491|gb|AEB37357.1| more axillary branches 2 [Helianthus annuus] gi|328691493|gb|AEB37358.1| more axillary branches 2 [Helianthus annuus] gi|328691495|gb|AEB37359.1| more axillary branches 2 [Helianthus annuus] gi|328691497|gb|AEB37360.1| more axillary branches 2 [Helianthus annuus] gi|328691499|gb|AEB37361.1| more axillary branches 2 [Helianthus annuus] gi|328691505|gb|AEB37364.1| more axillary branches 2 [Helianthus annuus] gi|328691507|gb|AEB37365.1| more axillary branches 2 [Helianthus annuus] gi|328691523|gb|AEB37373.1| more axillary branches 2 [Helianthus annuus] gi|328691525|gb|AEB37374.1| more axillary branches 2 [Helianthus annuus] gi|328691527|gb|AEB37375.1| more axillary branches 2 [Helianthus annuus] gi|328691537|gb|AEB37380.1| more axillary branches 2 [Helianthus annuus] gi|328691539|gb|AEB37381.1| more axillary branches 2 [Helianthus annuus] gi|328691553|gb|AEB37388.1| more axillary branches 2 [Helianthus annuus] gi|328691555|gb|AEB37389.1| more axillary branches 2 [Helianthus annuus] gi|328691577|gb|AEB37400.1| more axillary branches 2 [Helianthus annuus] gi|328691579|gb|AEB37401.1| more axillary branches 2 [Helianthus annuus] gi|328691589|gb|AEB37406.1| more axillary branches 2 [Helianthus annuus] gi|328691595|gb|AEB37409.1| more axillary branches 2 [Helianthus annuus] gi|328691597|gb|AEB37410.1| more axillary branches 2 [Helianthus annuus] gi|328691603|gb|AEB37413.1| more axillary branches 2 [Helianthus annuus] gi|328691607|gb|AEB37415.1| more axillary branches 2 [Helianthus annuus] gi|328691609|gb|AEB37416.1| more axillary branches 2 [Helianthus annuus] gi|328691611|gb|AEB37417.1| more axillary branches 2 [Helianthus annuus] gi|328691613|gb|AEB37418.1| more axillary branches 2 [Helianthus annuus] gi|328691615|gb|AEB37419.1| more axillary branches 2 [Helianthus annuus] gi|328691617|gb|AEB37420.1| more axillary branches 2 [Helianthus annuus] gi|328691619|gb|AEB37421.1| more axillary branches 2 [Helianthus annuus] gi|328691621|gb|AEB37422.1| more axillary branches 2 [Helianthus annuus] Length = 228 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 148 ERSTRTTLAIRGNIRNLYMIPSCFESVKDLNLSLLSPWGSP 26 ERSTR++L +RGN R+L+M+PSCF SV L+LSLLSPWG P Sbjct: 19 ERSTRSSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHP 59