BLASTX nr result
ID: Akebia23_contig00029946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00029946 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006405306.1| hypothetical protein EUTSA_v10027762mg [Eutr... 58 2e-06 ref|XP_006343878.1| PREDICTED: probable GABA transporter 2-like ... 57 3e-06 ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [V... 57 3e-06 ref|XP_004245533.1| PREDICTED: probable GABA transporter 2-like ... 56 4e-06 >ref|XP_006405306.1| hypothetical protein EUTSA_v10027762mg [Eutrema salsugineum] gi|557106444|gb|ESQ46759.1| hypothetical protein EUTSA_v10027762mg [Eutrema salsugineum] Length = 452 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 246 MAEPPRTDLFPETSRKDDAGAVFVLESKGNWWHA 347 MA+PPR+DLFP T DAGA+FVL+SKG WWHA Sbjct: 1 MADPPRSDLFPSTRLDFDAGALFVLQSKGEWWHA 34 >ref|XP_006343878.1| PREDICTED: probable GABA transporter 2-like [Solanum tuberosum] Length = 454 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +3 Query: 252 EPPRTDLFPETSRKDDAGAVFVLESKGNWWHA 347 EP R D FPE R+DDAGA FVLESKG WWHA Sbjct: 5 EPVRNDPFPENRREDDAGAAFVLESKGEWWHA 36 >ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera] gi|297742313|emb|CBI34462.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 246 MAEPPRTDLFPETSRKDDAGAVFVLESKGNWWHA 347 +AEP D FPE +R++DAGAVFVLESKG WWHA Sbjct: 4 IAEPLHVDPFPEQNREEDAGAVFVLESKGTWWHA 37 >ref|XP_004245533.1| PREDICTED: probable GABA transporter 2-like [Solanum lycopersicum] Length = 454 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +3 Query: 252 EPPRTDLFPETSRKDDAGAVFVLESKGNWWHA 347 EP R D FPE R+DDAGA FVLESKG WWHA Sbjct: 5 EPIRNDPFPENRREDDAGAAFVLESKGEWWHA 36