BLASTX nr result
ID: Akebia23_contig00029801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00029801 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS81020.1| hypothetical protein PFICI_06022 [Pestalotiopsis ... 59 5e-07 >gb|ETS81020.1| hypothetical protein PFICI_06022 [Pestalotiopsis fici W106-1] Length = 71 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = +2 Query: 74 MSGLADKVKNLGGDKASQGSQPGNSAERSADDSANQGINQAAGSAGVPQQAN 229 MSGL +KN DK + SQPGNS ER+AD NQ +NQ A GVPQ A+ Sbjct: 1 MSGLMGDIKNAASDKLGKDSQPGNSVERTADQDVNQEVNQFASDHGVPQSAD 52