BLASTX nr result
ID: Akebia23_contig00029778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00029778 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS78310.1| hypothetical protein PFICI_10372 [Pestalotiopsis ... 58 1e-06 >gb|ETS78310.1| hypothetical protein PFICI_10372 [Pestalotiopsis fici W106-1] Length = 211 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 268 AKGITEIKKSDIPKPIEGGAYAKLRLERSNKRQQG 164 ++G+ EI K+D+PK +EGGAY KLRLERSNKRQQG Sbjct: 160 SEGVYEISKNDVPKAVEGGAYTKLRLERSNKRQQG 194