BLASTX nr result
ID: Akebia23_contig00027102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00027102 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDM29570.1| unnamed protein product [Penicillium roqueforti] 71 2e-10 gb|EMD68508.1| hypothetical protein COCSADRAFT_33402 [Bipolaris ... 70 4e-10 gb|EOA84030.1| hypothetical protein SETTUDRAFT_164344 [Setosphae... 69 9e-10 gb|EKG12204.1| hypothetical protein MPH_10687 [Macrophomina phas... 68 1e-09 gb|EUC41843.1| hypothetical protein COCMIDRAFT_8512 [Bipolaris o... 68 1e-09 ref|XP_003713238.1| hypothetical protein MGG_10856 [Magnaporthe ... 68 1e-09 gb|EOO01293.1| hypothetical protein UCRPA7_3203 [Togninia minima... 67 2e-09 ref|XP_003007108.1| predicted protein [Verticillium alfalfae VaM... 67 2e-09 ref|XP_002479867.1| conserved hypothetical protein [Talaromyces ... 67 2e-09 gb|EGY20139.1| hypothetical protein VDAG_02155 [Verticillium dah... 67 3e-09 ref|XP_003007111.1| hypothetical protein VDBG_03250 [Verticilliu... 67 3e-09 ref|XP_001556011.1| predicted protein [Botryotinia fuckeliana B0... 67 3e-09 gb|EUN22180.1| hypothetical protein COCVIDRAFT_30751 [Bipolaris ... 66 4e-09 gb|EUC32573.1| hypothetical protein COCCADRAFT_5757 [Bipolaris z... 66 4e-09 ref|XP_002568686.1| Pc21g16860 [Penicillium chrysogenum Wisconsi... 66 4e-09 gb|EMD96701.1| hypothetical protein COCHEDRAFT_1018530 [Bipolari... 66 6e-09 gb|ESZ93580.1| hypothetical protein SBOR_6009 [Sclerotinia borea... 65 7e-09 gb|EHY54480.1| hypothetical protein HMPREF1120_02648 [Exophiala ... 65 7e-09 gb|ERS98792.1| hypothetical protein HMPREF1624_03982 [Sporothrix... 65 1e-08 gb|EKV10949.1| hypothetical protein PDIG_54370 [Penicillium digi... 65 1e-08 >emb|CDM29570.1| unnamed protein product [Penicillium roqueforti] Length = 78 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DYVDKA AG KK G++ R T EKITDGAR A+EK TGK VSDKISN Sbjct: 30 DDYVDKAFGAGVKKSGYNVDRNTQEKITDGARSAYEKATGKHVSDKISN 78 >gb|EMD68508.1| hypothetical protein COCSADRAFT_33402 [Bipolaris sorokiniana ND90Pr] Length = 75 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 6/55 (10%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRET------NEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG + + +T NEKITDGAR FEK TGK VSDKISN Sbjct: 21 EDYLDKGLDAVEKKYGGASTEDTQRHRGVNEKITDGARNMFEKATGKDVSDKISN 75 >gb|EOA84030.1| hypothetical protein SETTUDRAFT_164344 [Setosphaeria turcica Et28A] Length = 68 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/55 (63%), Positives = 39/55 (70%), Gaps = 6/55 (10%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRET------NEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG S ++T NEKITDGAR FEK TGK V +KISN Sbjct: 14 EDYLDKGLDAAEKKYGGSMGQDTQKNRAINEKITDGARNMFEKATGKHVPEKISN 68 >gb|EKG12204.1| hypothetical protein MPH_10687 [Macrophomina phaseolina MS6] Length = 78 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/55 (63%), Positives = 38/55 (69%), Gaps = 6/55 (10%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRET------NEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG S ++T NEKITDG RG FE TGK V DKISN Sbjct: 24 EDYLDKGLDAAEKKYGGSWGQDTQKHRAMNEKITDGVRGKFESATGKNVPDKISN 78 >gb|EUC41843.1| hypothetical protein COCMIDRAFT_8512 [Bipolaris oryzae ATCC 44560] Length = 76 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/55 (63%), Positives = 39/55 (70%), Gaps = 6/55 (10%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRET------NEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG + + +T NEKITDGAR FEK TGK V DKISN Sbjct: 22 EDYLDKGLDAVEKKYGGASTEDTQKYRSVNEKITDGARNMFEKATGKDVPDKISN 76 >ref|XP_003713238.1| hypothetical protein MGG_10856 [Magnaporthe oryzae 70-15] gi|351645570|gb|EHA53431.1| hypothetical protein MGG_10856 [Magnaporthe oryzae 70-15] gi|440474038|gb|ELQ42806.1| hypothetical protein OOU_Y34scaffold00193g6 [Magnaporthe oryzae Y34] gi|440478340|gb|ELQ59181.1| hypothetical protein OOW_P131scaffold01380g8 [Magnaporthe oryzae P131] Length = 73 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -1 Query: 239 DYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 DY DKA DA KK GH R T+EKITD ARGAFEKVTGK+V+ KISN Sbjct: 26 DYGDKAFDALAKKSGHPVDRNTSEKITDAARGAFEKVTGKKVNPKISN 73 >gb|EOO01293.1| hypothetical protein UCRPA7_3203 [Togninia minima UCRPA7] Length = 67 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DY+DKA + G KK GH+ + T EKITDGARG FEK TGK+V K+SN Sbjct: 19 DDYLDKAFNMGAKKSGHNVDKNTGEKITDGARGLFEKATGKKVDPKVSN 67 >ref|XP_003007108.1| predicted protein [Verticillium alfalfae VaMs.102] gi|261354710|gb|EEY17138.1| predicted protein [Verticillium alfalfae VaMs.102] Length = 76 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DYVDKA DAG KK GHS R T EK+TD RG FEK TGK V +SN Sbjct: 28 QDYVDKAFDAGVKKSGHSMDRNTQEKVTDAGRGMFEKQTGKNVPHNVSN 76 >ref|XP_002479867.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218720014|gb|EED19433.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 75 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 5/54 (9%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQ-----SRETNEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LD EKKYG + R+TNEKITDGAR FEKVTGK V +K SN Sbjct: 22 EDYLDKGLDFAEKKYGQGKIDPVKMRDTNEKITDGARNLFEKVTGKHVPEKFSN 75 >gb|EGY20139.1| hypothetical protein VDAG_02155 [Verticillium dahliae VdLs.17] Length = 75 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DY DKA D KK GH+ R T EKITDG R A+EK TG +VSDKISN Sbjct: 27 QDYADKAFDFASKKSGHNIDRNTQEKITDGGRSAYEKATGSKVSDKISN 75 >ref|XP_003007111.1| hypothetical protein VDBG_03250 [Verticillium alfalfae VaMs.102] gi|261354713|gb|EEY17141.1| hypothetical protein VDBG_03250 [Verticillium alfalfae VaMs.102] Length = 75 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DY DKA D KK GH+ R T EKITDG R A+EK TG +VSDKISN Sbjct: 27 QDYADKAFDFASKKSGHNIDRNTQEKITDGGRSAYEKATGSKVSDKISN 75 >ref|XP_001556011.1| predicted protein [Botryotinia fuckeliana B05.10] gi|347827055|emb|CCD42752.1| hypothetical protein BofuT4_uP073640.1 [Botryotinia fuckeliana T4] gi|472238612|gb|EMR83470.1| hypothetical protein BcDW1_7904 [Botryotinia fuckeliana BcDW1] Length = 79 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 EDY DKALD EKK GH+ SR+ NEKITDGARG +EK TG V+ K SN Sbjct: 31 EDYGDKALDFIEKKSGHTLSRDQNEKITDGARGLYEKQTGNAVNPKFSN 79 >gb|EUN22180.1| hypothetical protein COCVIDRAFT_30751 [Bipolaris victoriae FI3] Length = 76 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/55 (61%), Positives = 38/55 (69%), Gaps = 6/55 (10%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRET------NEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG + + +T NEKITDGAR FEK TGK V DK SN Sbjct: 22 EDYLDKGLDAVEKKYGGASTEDTQRYRSVNEKITDGARNMFEKATGKDVPDKFSN 76 >gb|EUC32573.1| hypothetical protein COCCADRAFT_5757 [Bipolaris zeicola 26-R-13] Length = 77 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/55 (61%), Positives = 38/55 (69%), Gaps = 6/55 (10%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRET------NEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG + + +T NEKITDGAR FEK TGK V DK SN Sbjct: 23 EDYLDKGLDAVEKKYGGASTEDTQRYRGVNEKITDGARNMFEKATGKDVPDKFSN 77 >ref|XP_002568686.1| Pc21g16860 [Penicillium chrysogenum Wisconsin 54-1255] gi|211590397|emb|CAP96583.1| Pc21g16860 [Penicillium chrysogenum Wisconsin 54-1255] Length = 76 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DYVDKA AG KK G++ R EKITDGAR A+EK TGK VSDK+SN Sbjct: 28 DDYVDKAFAAGVKKSGYNIDRNMQEKITDGAREAYEKATGKPVSDKVSN 76 >gb|EMD96701.1| hypothetical protein COCHEDRAFT_1018530 [Bipolaris maydis C5] gi|477586484|gb|ENI03568.1| hypothetical protein COCC4DRAFT_32844 [Bipolaris maydis ATCC 48331] Length = 75 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/55 (61%), Positives = 38/55 (69%), Gaps = 6/55 (10%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRET------NEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG + + +T NEKITDGAR FEK TGK V DK SN Sbjct: 21 EDYLDKGLDAVEKKYGGATAEDTQKYRGVNEKITDGARNMFEKATGKNVPDKFSN 75 >gb|ESZ93580.1| hypothetical protein SBOR_6009 [Sclerotinia borealis F-4157] Length = 85 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 EDY DK LD EKK GH+ +RE NEKITDGARG +EK TG V+ K SN Sbjct: 37 EDYGDKGLDFIEKKTGHTLTREQNEKITDGARGLYEKQTGSAVNSKFSN 85 >gb|EHY54480.1| hypothetical protein HMPREF1120_02648 [Exophiala dermatitidis NIH/UT8656] Length = 67 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 5/54 (9%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGH-----SQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 EDY+DK LDA EKKYG ++ R TNEKITD ARG EK TGK + DKISN Sbjct: 14 EDYLDKGLDAVEKKYGGGKIDPAKQRSTNEKITDKARGLVEKATGKDIPDKISN 67 >gb|ERS98792.1| hypothetical protein HMPREF1624_03982 [Sporothrix schenckii ATCC 58251] Length = 90 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -1 Query: 242 EDYVDKALDAGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DY DKA + KK GH + ET+EKITDGARGAFEKVTGK+V K SN Sbjct: 42 QDYGDKAFNFVSKKTGHQVNPETSEKITDGARGAFEKVTGKKVDPKYSN 90 >gb|EKV10949.1| hypothetical protein PDIG_54370 [Penicillium digitatum PHI26] gi|425774980|gb|EKV13271.1| hypothetical protein PDIP_49590 [Penicillium digitatum Pd1] Length = 552 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/53 (66%), Positives = 38/53 (71%), Gaps = 4/53 (7%) Frame = -1 Query: 242 EDYVDKALD----AGEKKYGHSQSRETNEKITDGARGAFEKVTGKQVSDKISN 96 +DYVDKA AG KK G++ R EKITDGAR AFEKVTGK VSDKISN Sbjct: 500 DDYVDKAFASAFAAGVKKSGYNLDRSAQEKITDGAREAFEKVTGKHVSDKISN 552