BLASTX nr result
ID: Akebia23_contig00026982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00026982 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214755.1| hypothetical protein PRUPE_ppa024905mg [Prun... 60 3e-07 ref|XP_007212689.1| hypothetical protein PRUPE_ppa018526m1g, par... 59 9e-07 ref|XP_007214101.1| hypothetical protein PRUPE_ppa016834mg, part... 58 2e-06 ref|XP_003631328.1| PREDICTED: LRR receptor-like serine/threonin... 58 2e-06 ref|XP_002273399.2| PREDICTED: LRR receptor-like serine/threonin... 57 2e-06 ref|XP_002263766.1| PREDICTED: receptor-like protein 12-like [Vi... 57 2e-06 emb|CAN76220.1| hypothetical protein VITISV_020133 [Vitis vinifera] 57 2e-06 ref|XP_002272920.2| PREDICTED: leucine-rich repeat receptor prot... 57 3e-06 emb|CAN63882.1| hypothetical protein VITISV_002032 [Vitis vinifera] 57 3e-06 ref|XP_004295756.1| PREDICTED: tyrosine-sulfated glycopeptide re... 57 4e-06 ref|XP_002265946.1| PREDICTED: leucine-rich repeat receptor prot... 57 4e-06 ref|XP_007011096.1| Disease resistance family protein / LRR fami... 56 5e-06 ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonin... 56 5e-06 ref|XP_002514937.1| serine/threonine-protein kinase bri1, putati... 56 5e-06 ref|XP_006447088.1| hypothetical protein CICLE_v10017744mg [Citr... 56 6e-06 ref|XP_007021415.1| Disease resistance family protein / LRR fami... 56 6e-06 ref|XP_007214009.1| hypothetical protein PRUPE_ppa014796mg [Prun... 56 6e-06 ref|XP_007213308.1| hypothetical protein PRUPE_ppb023904mg [Prun... 56 6e-06 ref|XP_007212603.1| hypothetical protein PRUPE_ppa016919mg, part... 56 6e-06 ref|XP_007203166.1| hypothetical protein PRUPE_ppa025019mg, part... 56 6e-06 >ref|XP_007214755.1| hypothetical protein PRUPE_ppa024905mg [Prunus persica] gi|462410620|gb|EMJ15954.1| hypothetical protein PRUPE_ppa024905mg [Prunus persica] Length = 972 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/45 (53%), Positives = 35/45 (77%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKK 137 +GF GVW LL KK+WRYAYFRF +DI +K+ + I + +AR+++K Sbjct: 927 VGFWGVWGTLLVKKSWRYAYFRFFDDIKNKVLLAIELKLARMQRK 971 >ref|XP_007212689.1| hypothetical protein PRUPE_ppa018526m1g, partial [Prunus persica] gi|462408554|gb|EMJ13888.1| hypothetical protein PRUPE_ppa018526m1g, partial [Prunus persica] Length = 214 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKK 137 +GF GV LL KK+WRYAYFRF +D DK+ + IA+ VARL++K Sbjct: 166 VGFWGVCGTLLLKKSWRYAYFRFFDDTKDKVTLAIALKVARLQRK 210 >ref|XP_007214101.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica] gi|462409966|gb|EMJ15300.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica] Length = 977 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKK 137 +GF GV LL KK+WRYAYFRF ++ DK+ + IA+ VARL+KK Sbjct: 929 VGFWGVCGTLLLKKSWRYAYFRFFDNTKDKVTLAIALKVARLQKK 973 >ref|XP_003631328.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Length = 1001 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/49 (48%), Positives = 37/49 (75%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF V+ L+ KK+WR AYFRF+++ D+L+V A+ VARLK+K++ N Sbjct: 949 VGFWVVYGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKMEAN 997 >ref|XP_002273399.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Length = 1007 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF V L+ KK+WR AYFRF+++ D+L+V A+ VARLK+K++ N Sbjct: 955 VGFWAVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKMEAN 1003 >ref|XP_002263766.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Length = 957 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF V L+ KK+WR AYFRF+++ D+L+V A+ VARLK+K++ N Sbjct: 905 VGFWAVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKMEAN 953 >emb|CAN76220.1| hypothetical protein VITISV_020133 [Vitis vinifera] Length = 939 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF V L+ KK+WR AYFRF+++ D+L+V A+ VARLK+K++ N Sbjct: 887 VGFWAVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKMEAN 935 >ref|XP_002272920.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Length = 955 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF + L+ KK+WR AYFRF+++ D+L+V A+ VARLK+K++ N Sbjct: 903 VGFWAICGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKMEAN 951 >emb|CAN63882.1| hypothetical protein VITISV_002032 [Vitis vinifera] Length = 898 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF V L+ KK+WR AYFRF+++ D+L+V A+ VARLK+K++ N Sbjct: 846 VGFWXVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKMEAN 894 >ref|XP_004295756.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Fragaria vesca subsp. vesca] Length = 495 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/45 (48%), Positives = 35/45 (77%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKK 137 IGF GV+ ++F + WRYAY+ FL+++HD+ VMIA +AR+K++ Sbjct: 447 IGFWGVFGPIVFLQKWRYAYYHFLDNVHDRFMVMIAKSMARVKRR 491 >ref|XP_002265946.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Vitis vinifera] Length = 969 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/49 (48%), Positives = 35/49 (71%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF V L KK+WR AYFRF+++ D+L+V A+ VARLK+K++ N Sbjct: 917 VGFWAVCGSLALKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKMETN 965 >ref|XP_007011096.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] gi|508728009|gb|EOY19906.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] Length = 434 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/47 (53%), Positives = 37/47 (78%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLK 143 IGF GV++ LL K++WR+AYFRFL+++ D L+V I + AR ++KLK Sbjct: 363 IGFWGVFATLLSKRSWRHAYFRFLDNLKDSLYVTIMLWGARSQRKLK 409 >ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Length = 958 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKL 140 IGF GV L+ K +WRYAYFRF+E + D+L + +A+ VARL +K+ Sbjct: 913 IGFWGVCGTLIIKTSWRYAYFRFVEKMKDRLLLAVALNVARLTRKV 958 >ref|XP_002514937.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223545988|gb|EEF47491.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Length = 987 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/49 (46%), Positives = 38/49 (77%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLKIN 149 +GF V L+ KKTWR+AYF+F++++ D+LF++I + +ARL+ KL+ N Sbjct: 939 VGFWVVCGTLVIKKTWRHAYFKFIDEMKDRLFLVIFLNMARLRTKLESN 987 >ref|XP_006447088.1| hypothetical protein CICLE_v10017744mg [Citrus clementina] gi|568831750|ref|XP_006470122.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Citrus sinensis] gi|557549699|gb|ESR60328.1| hypothetical protein CICLE_v10017744mg [Citrus clementina] Length = 917 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKL 140 +GF GV L+ KK+WRYAYF+F + I D+L +A+ V RLK+K+ Sbjct: 863 MGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKM 908 >ref|XP_007021415.1| Disease resistance family protein / LRR family protein [Theobroma cacao] gi|508721043|gb|EOY12940.1| Disease resistance family protein / LRR family protein [Theobroma cacao] Length = 882 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/47 (46%), Positives = 36/47 (76%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLK 143 +GF G+ LLFK++WR+AYFRFL+D+ D L+V + ARL+++++ Sbjct: 835 VGFWGICGALLFKRSWRHAYFRFLDDMKDWLYVRFVLQKARLERRIR 881 >ref|XP_007214009.1| hypothetical protein PRUPE_ppa014796mg [Prunus persica] gi|462409874|gb|EMJ15208.1| hypothetical protein PRUPE_ppa014796mg [Prunus persica] Length = 1013 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKK 137 +GF GV LL KK+WRYAYF+F +DI DK+ + IA+ +A L++K Sbjct: 968 VGFWGVCGTLLLKKSWRYAYFQFFDDIKDKVSLAIALKLAHLQRK 1012 >ref|XP_007213308.1| hypothetical protein PRUPE_ppb023904mg [Prunus persica] gi|462409173|gb|EMJ14507.1| hypothetical protein PRUPE_ppb023904mg [Prunus persica] Length = 739 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/47 (44%), Positives = 34/47 (72%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLK 143 +GF GV L+ KTWRYAYFRF++++ D+L+ M+ M + +K+ L+ Sbjct: 692 VGFWGVCGSLVINKTWRYAYFRFVDNVQDRLYAMVTMRINTIKRSLR 738 >ref|XP_007212603.1| hypothetical protein PRUPE_ppa016919mg, partial [Prunus persica] gi|462408468|gb|EMJ13802.1| hypothetical protein PRUPE_ppa016919mg, partial [Prunus persica] Length = 612 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/47 (42%), Positives = 35/47 (74%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKKLK 143 +GF GV L+ KTWRY YFRF+ ++ ++L+VM+ M + ++K++L+ Sbjct: 565 VGFWGVCGSLVVNKTWRYVYFRFINNVQERLYVMVIMSINKMKRRLR 611 >ref|XP_007203166.1| hypothetical protein PRUPE_ppa025019mg, partial [Prunus persica] gi|462398697|gb|EMJ04365.1| hypothetical protein PRUPE_ppa025019mg, partial [Prunus persica] Length = 765 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 3 IGFLGVWSVLLFKKTWRYAYFRFLEDIHDKLFVMIAMGVARLKKK 137 +GF GV+ LL KK+WRYAYFRF +D DK+ + I + V RL++K Sbjct: 717 VGFWGVFGTLLVKKSWRYAYFRFFDDTKDKVTLAIELKVTRLQRK 761