BLASTX nr result
ID: Akebia23_contig00026917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00026917 (221 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836183.1| hypothetical protein AMTR_s00101p00064390 [A... 80 3e-13 gb|ADV78082.1| calcium- and calmodulin-dependent protein kinase,... 80 3e-13 ref|XP_006432551.1| hypothetical protein CICLE_v10000859mg [Citr... 74 2e-11 ref|XP_006347696.1| PREDICTED: calcium and calcium/calmodulin-de... 74 3e-11 gb|EYU42904.1| hypothetical protein MIMGU_mgv1a020107mg [Mimulus... 73 4e-11 ref|XP_007010660.1| Calcium and calcium/calmodulin-dependent ser... 73 4e-11 ref|XP_004230058.1| PREDICTED: calcium and calcium/calmodulin-de... 73 4e-11 ref|XP_006378841.1| hypothetical protein POPTR_0010s25360g, part... 72 6e-11 emb|CCW43374.1| calcium and calmodulin-dependent kinase [Casuari... 72 6e-11 gb|ADV78077.1| calcium- and calmodulin-dependent protein kinase,... 72 6e-11 ref|XP_002512205.1| calcium-dependent protein kinase, putative [... 72 8e-11 gb|AAD52092.1|AF087813_1 calcium/calmodulin dependent protein ki... 72 1e-10 gb|ABQ95545.1| CCaMK [Petunia x hybrida] 72 1e-10 gb|AAD28791.1|AF145593_1 calcium/calmodulin-dependent protein ki... 72 1e-10 ref|XP_004300049.1| PREDICTED: calcium and calcium/calmodulin-de... 71 2e-10 emb|CBI29153.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002273342.1| PREDICTED: calcium and calcium/calmodulin-de... 71 2e-10 gb|ADV78070.1| calcium- and calmodulin-dependent protein kinase ... 70 2e-10 gb|EXB97714.1| Calcium and calcium/calmodulin-dependent serine/t... 70 3e-10 ref|XP_004140929.1| PREDICTED: LOW QUALITY PROTEIN: calcium and ... 70 3e-10 >ref|XP_006836183.1| hypothetical protein AMTR_s00101p00064390 [Amborella trichopoda] gi|548838683|gb|ERM99036.1| hypothetical protein AMTR_s00101p00064390 [Amborella trichopoda] Length = 520 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA+GLG LHQANIVHRDLKPEN LFLNKSE SPLKIMDFGL+ Sbjct: 145 AAVVRQIASGLGGLHQANIVHRDLKPENCLFLNKSEDSPLKIMDFGLS 192 >gb|ADV78082.1| calcium- and calmodulin-dependent protein kinase, partial [Amborella trichopoda] Length = 451 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA+GLG LHQANIVHRDLKPEN LFLNKSE SPLKIMDFGL+ Sbjct: 117 AAVVRQIASGLGGLHQANIVHRDLKPENCLFLNKSEDSPLKIMDFGLS 164 >ref|XP_006432551.1| hypothetical protein CICLE_v10000859mg [Citrus clementina] gi|568834469|ref|XP_006471350.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Citrus sinensis] gi|557534673|gb|ESR45791.1| hypothetical protein CICLE_v10000859mg [Citrus clementina] Length = 522 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A V+ +IA GL LHQANIVHRDLKPEN LFLN E SPLKIMDFGL+ Sbjct: 146 AAVIRQIAEGLAALHQANIVHRDLKPENCLFLNDREDSPLKIMDFGLS 193 >ref|XP_006347696.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Solanum tuberosum] Length = 515 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GL LH ANIVHRDLKPEN LFLNK E SPLKIMDFGL+ Sbjct: 139 AAVVRQIAKGLEALHGANIVHRDLKPENCLFLNKDENSPLKIMDFGLS 186 >gb|EYU42904.1| hypothetical protein MIMGU_mgv1a020107mg [Mimulus guttatus] Length = 512 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IANGL LH+A IVHRDLKPEN LFL+K E SPLKIMDFGL+ Sbjct: 138 AAVVRQIANGLTALHRAGIVHRDLKPENCLFLSKEEESPLKIMDFGLS 185 >ref|XP_007010660.1| Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase [Theobroma cacao] gi|508727573|gb|EOY19470.1| Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase [Theobroma cacao] Length = 524 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GL LHQANIVHRDLKPEN LF NKS+ S LKIMDFGL+ Sbjct: 149 AAVVKQIAQGLAALHQANIVHRDLKPENCLFFNKSDDSTLKIMDFGLS 196 >ref|XP_004230058.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Solanum lycopersicum] Length = 516 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GL LH ANIVHRDLKPEN LFLNK E SPLKIMDFGL+ Sbjct: 140 ASVVRQIAKGLEALHGANIVHRDLKPENCLFLNKDENSPLKIMDFGLS 187 >ref|XP_006378841.1| hypothetical protein POPTR_0010s25360g, partial [Populus trichocarpa] gi|550330580|gb|ERP56638.1| hypothetical protein POPTR_0010s25360g, partial [Populus trichocarpa] Length = 398 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GLG LH+ANIVHRDLKPEN LFLN+++ S LKIMDFGL+ Sbjct: 136 AAVVRQIAEGLGALHRANIVHRDLKPENCLFLNENDDSTLKIMDFGLS 183 >emb|CCW43374.1| calcium and calmodulin-dependent kinase [Casuarina glauca] gi|511630598|emb|CCW43375.1| calcium and calmodulin-dependent kinase [Casuarina glauca] Length = 520 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV ++A GL LHQANIVHRDLKPEN LFL+KS SPLKIMDFGL+ Sbjct: 145 AAVVRQLAEGLVALHQANIVHRDLKPENCLFLDKSADSPLKIMDFGLS 192 >gb|ADV78077.1| calcium- and calmodulin-dependent protein kinase, partial [Maianthemum racemosum] Length = 452 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA+GL LH+A+IVHRDLKPEN LFLN SE SPLKIMDFGL+ Sbjct: 118 AQVVRQIASGLDALHKASIVHRDLKPENCLFLNSSERSPLKIMDFGLS 165 >ref|XP_002512205.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223548749|gb|EEF50239.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 508 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A V+ +IA GLG +HQANI+HRDLKPEN LFLN+ + S LKIMDFGL+ Sbjct: 133 AAVIRQIARGLGAIHQANIIHRDLKPENCLFLNEKDDSTLKIMDFGLS 180 >gb|AAD52092.1|AF087813_1 calcium/calmodulin dependent protein kinase [Nicotiana tabacum] gi|6649536|gb|AAF21450.1|U38446_1 calcium/calmodulin dependent protein kinase [Nicotiana tabacum] Length = 517 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GL LH A+IVHRDLKPEN LFLNK E SPLKIMDFGL+ Sbjct: 142 AAVVRQIAKGLEALHGASIVHRDLKPENCLFLNKDENSPLKIMDFGLS 189 >gb|ABQ95545.1| CCaMK [Petunia x hybrida] Length = 534 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GL LH A+IVHRDLKPEN LFLNK E SPLKIMDFGL+ Sbjct: 138 AAVVRQIAKGLEALHGASIVHRDLKPENCLFLNKDENSPLKIMDFGLS 185 >gb|AAD28791.1|AF145593_1 calcium/calmodulin-dependent protein kinase [Nicotiana tabacum] gi|5814095|gb|AAD52098.1|U70923_1 calcium/calmodulin-dependent protein kinase [Nicotiana tabacum] Length = 517 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GL LH A+IVHRDLKPEN LFLNK E SPLKIMDFGL+ Sbjct: 142 AAVVRQIAKGLEALHGASIVHRDLKPENCLFLNKDENSPLKIMDFGLS 189 >ref|XP_004300049.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Fragaria vesca subsp. vesca] Length = 523 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA GL LH++NIVHRDLKPEN LFLN + SPLKIMDFGL+ Sbjct: 148 AAVVRQIAQGLAALHKSNIVHRDLKPENCLFLNSCDDSPLKIMDFGLS 195 >emb|CBI29153.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV ++A GL LHQANI+HRDLKPEN LFL+KSE + LKIMDFGL+ Sbjct: 122 AAVVKQLAEGLKALHQANIIHRDLKPENCLFLDKSEDATLKIMDFGLS 169 >ref|XP_002273342.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 [Vitis vinifera] Length = 520 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV ++A GL LHQANI+HRDLKPEN LFL+KSE + LKIMDFGL+ Sbjct: 145 AAVVKQLAEGLKALHQANIIHRDLKPENCLFLDKSEDATLKIMDFGLS 192 >gb|ADV78070.1| calcium- and calmodulin-dependent protein kinase [Phaeoceros laevis] Length = 526 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A V+ +IANGL LHQA+IVHRDLKPEN LFL + SPLKIMDFGL+ Sbjct: 149 AAVIKQIANGLHSLHQAHIVHRDLKPENCLFLTQDHSSPLKIMDFGLS 196 >gb|EXB97714.1| Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase [Morus notabilis] Length = 593 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A V +IA GL LH+ANIVHRDLKPEN LFLN S+ SPLKIMDFGL+ Sbjct: 218 AAVTRQIAAGLEALHRANIVHRDLKPENCLFLNGSQDSPLKIMDFGLS 265 >ref|XP_004140929.1| PREDICTED: LOW QUALITY PROTEIN: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Cucumis sativus] Length = 487 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = +1 Query: 4 AIVVSEIANGLGVLHQANIVHRDLKPENFLFLNKSEVSPLKIMDFGLT 147 A VV +IA+GL LH+ANI+HRDLKPEN LFLN+S+ S LKIMDFGL+ Sbjct: 143 AEVVRQIASGLKALHEANIIHRDLKPENCLFLNQSQDSSLKIMDFGLS 190