BLASTX nr result
ID: Akebia23_contig00026769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00026769 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283496.2| PREDICTED: pre-mRNA-processing factor 40 hom... 65 1e-08 emb|CBI19367.3| unnamed protein product [Vitis vinifera] 63 4e-08 >ref|XP_002283496.2| PREDICTED: pre-mRNA-processing factor 40 homolog B-like [Vitis vinifera] Length = 1020 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = +3 Query: 177 VFAAVWLLVEMAGNPQSSGAQPLRPPLPGSTGPQNFGPPISMQ 305 +F L MA NPQSSGAQPLRPP GS GPQNFGPP+SMQ Sbjct: 5 LFEEACLCAGMANNPQSSGAQPLRPPAVGSMGPQNFGPPLSMQ 47 >emb|CBI19367.3| unnamed protein product [Vitis vinifera] Length = 1030 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +3 Query: 207 MAGNPQSSGAQPLRPPLPGSTGPQNFGPPISMQ 305 MA NPQSSGAQPLRPP GS GPQNFGPP+SMQ Sbjct: 1 MANNPQSSGAQPLRPPAVGSMGPQNFGPPLSMQ 33