BLASTX nr result
ID: Akebia23_contig00023987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00023987 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera] 70 3e-16 emb|CAA36615.1| unnamed protein product [Solanum tuberosum] 63 9e-14 emb|CAN69872.1| hypothetical protein VITISV_032285 [Vitis vinifera] 59 8e-13 emb|CAN75434.1| hypothetical protein VITISV_027911 [Vitis vinifera] 63 1e-12 ref|XP_004514121.1| PREDICTED: uncharacterized protein LOC101493... 62 3e-12 emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera] 59 8e-12 emb|CAN80061.1| hypothetical protein VITISV_007942 [Vitis vinifera] 60 1e-11 emb|CAN77904.1| hypothetical protein VITISV_024390 [Vitis vinifera] 64 3e-11 emb|CAN73351.1| hypothetical protein VITISV_027250 [Vitis vinifera] 57 4e-11 emb|CAN79196.1| hypothetical protein VITISV_000238 [Vitis vinifera] 60 5e-11 emb|CAN60626.1| hypothetical protein VITISV_018873 [Vitis vinifera] 65 7e-11 ref|XP_004513812.1| PREDICTED: uncharacterized protein LOC101489... 60 8e-11 emb|CAN83799.1| hypothetical protein VITISV_033272 [Vitis vinifera] 66 1e-10 emb|CAN73022.1| hypothetical protein VITISV_004050 [Vitis vinifera] 59 1e-10 emb|CAN80367.1| hypothetical protein VITISV_014719 [Vitis vinifera] 51 2e-10 emb|CAN62623.1| hypothetical protein VITISV_001656 [Vitis vinifera] 57 2e-10 emb|CAN60373.1| hypothetical protein VITISV_034932 [Vitis vinifera] 57 2e-10 emb|CAN61004.1| hypothetical protein VITISV_015023 [Vitis vinifera] 57 2e-10 emb|CAN73484.1| hypothetical protein VITISV_029448 [Vitis vinifera] 57 2e-10 emb|CAN73399.1| hypothetical protein VITISV_006541 [Vitis vinifera] 57 2e-10 >emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera] Length = 1505 Score = 70.5 bits (171), Expect(2) = 3e-16 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 425 VFVHEHRKIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 V +H+H + GKL+PRA KCVF+GY+PTQKGYKCFDPISKK Sbjct: 732 VHIHDHNR-GKLDPRARKCVFVGYAPTQKGYKCFDPISKK 770 Score = 40.0 bits (92), Expect(2) = 3e-16 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEIFKEDS 218 +K VTMDVTFFE +P+F HLQGE EDS Sbjct: 769 KKLFVTMDVTFFESKPFFAT-HLQGESTSEDS 799 >emb|CAA36615.1| unnamed protein product [Solanum tuberosum] Length = 675 Score = 63.2 bits (152), Expect(2) = 9e-14 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 428 TVFVHEHRKIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 T FVH H + KLEPRA KC+F+GY+P+QKGYKC+DP ++K Sbjct: 337 TTFVHVHNR-SKLEPRAKKCIFVGYAPSQKGYKCYDPHARK 376 Score = 38.9 bits (89), Expect(2) = 9e-14 Identities = 22/34 (64%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEI-FKEDSF 215 RK +VTMD+TFFE Q YF HLQGE EDSF Sbjct: 375 RKIIVTMDLTFFESQLYF-TTHLQGEYHLGEDSF 407 >emb|CAN69872.1| hypothetical protein VITISV_032285 [Vitis vinifera] Length = 843 Score = 58.9 bits (141), Expect(2) = 8e-13 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -2 Query: 425 VFVHEHRKIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 V ++ H++ KL+PRA+KC+F+GYSPT+KGYKC+ P SK+ Sbjct: 705 VHIYAHQRT-KLDPRALKCIFVGYSPTKKGYKCYHPASKR 743 Score = 40.0 bits (92), Expect(2) = 8e-13 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 301 VTMDVTFFEKQPYFKNIHLQGEIFKED 221 VTMDV+F EKQP+F + +LQGE F ED Sbjct: 746 VTMDVSFNEKQPFFSSPYLQGEPFAED 772 >emb|CAN75434.1| hypothetical protein VITISV_027911 [Vitis vinifera] Length = 1162 Score = 63.2 bits (152), Expect(2) = 1e-12 Identities = 26/46 (56%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 428 TVFVHEHRKI-GKLEPRAIKCVFIGYSPTQKGYKCFDPISKKCCHN 294 + FVH H++ KL+PRA+KC+F+GYSPTQKGYKC+ P+ K+ H+ Sbjct: 423 SAFVHVHQQHRDKLDPRALKCIFLGYSPTQKGYKCYSPVIKQFDHS 468 Score = 35.0 bits (79), Expect(2) = 1e-12 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 298 TMDVTFFEKQPYFKNIHLQGE 236 +MDVTFFE+QPYF +QGE Sbjct: 468 SMDVTFFEQQPYFSKSDIQGE 488 >ref|XP_004514121.1| PREDICTED: uncharacterized protein LOC101493292 [Cicer arietinum] Length = 1614 Score = 61.6 bits (148), Expect(2) = 3e-12 Identities = 25/46 (54%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 428 TVFVHEHR-KIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKKCCHN 294 T FVH+++ GKLEP+++KC+F+GY P +KGY+C+ PISKK H+ Sbjct: 656 TAFVHDNQPNKGKLEPKSLKCIFLGYPPNKKGYRCYCPISKKFYHS 701 Score = 35.4 bits (80), Expect(2) = 3e-12 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 298 TMDVTFFEKQPYFKNIHLQGE 236 +MDVTFFE QPY+ + LQGE Sbjct: 701 SMDVTFFENQPYYPKVGLQGE 721 >emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera] Length = 1360 Score = 59.3 bits (142), Expect(2) = 8e-12 Identities = 25/42 (59%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 428 TVFVHEHR-KIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 T FVH H+ + KL+P A KC+F+GYSP QKGYKC+ P +KK Sbjct: 682 TAFVHIHKSQHSKLDPTATKCIFLGYSPNQKGYKCYSPTTKK 723 Score = 36.2 bits (82), Expect(2) = 8e-12 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEIFKEDSF 215 +K +MDVTFFE QP++ +QGE + D F Sbjct: 722 KKFYTSMDVTFFENQPFYPKTAIQGENWSTDEF 754 >emb|CAN80061.1| hypothetical protein VITISV_007942 [Vitis vinifera] Length = 960 Score = 60.1 bits (144), Expect(2) = 1e-11 Identities = 25/44 (56%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -2 Query: 422 FVHEHRKI-GKLEPRAIKCVFIGYSPTQKGYKCFDPISKKCCHN 294 FVH H++ KL+PRA+KC+F+ YSPTQKGYKC+ P+ K+ H+ Sbjct: 252 FVHVHQQHRDKLDPRALKCIFLWYSPTQKGYKCYSPVIKQFYHS 295 Score = 35.0 bits (79), Expect(2) = 1e-11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 298 TMDVTFFEKQPYFKNIHLQGE 236 +MDVTFFE+QPYF +QGE Sbjct: 295 SMDVTFFEQQPYFSKSDIQGE 315 >emb|CAN77904.1| hypothetical protein VITISV_024390 [Vitis vinifera] Length = 1210 Score = 63.9 bits (154), Expect(2) = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 425 VFVHEHR-KIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 VF H H K KL+P+A+KCVF+GYS TQKGYKC+DPIS+K Sbjct: 546 VFFHTHEPKRNKLDPKALKCVFLGYSSTQKGYKCYDPISQK 586 Score = 29.6 bits (65), Expect(2) = 3e-11 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEIFKE 224 +K V++DVTFFE PY+ LQGE E Sbjct: 585 QKLYVSLDVTFFEHTPYYS---LQGESMSE 611 >emb|CAN73351.1| hypothetical protein VITISV_027250 [Vitis vinifera] Length = 1108 Score = 57.4 bits (137), Expect(2) = 4e-11 Identities = 24/42 (57%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -2 Query: 428 TVFVHEHR-KIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 T FVH H+ + KL+P A KC+F+GY P QKGYKC+ P +KK Sbjct: 496 TAFVHIHKSQRSKLDPTATKCIFVGYLPNQKGYKCYSPTTKK 537 Score = 35.8 bits (81), Expect(2) = 4e-11 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEIFKEDSFNSGYVFLSDDVFLS 173 +K +MDVTFFE QP++ +QGE + D F +S LS Sbjct: 536 KKFYTSMDVTFFENQPFYPKTAIQGENWSIDEFQFWETEISTTSLLS 582 >emb|CAN79196.1| hypothetical protein VITISV_000238 [Vitis vinifera] Length = 906 Score = 60.5 bits (145), Expect(2) = 5e-11 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 428 TVFVHEHRKI-GKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 T FVH H + KL+PRAIKCVF+GYS TQKGYKC++P ++K Sbjct: 359 TAFVHVHSQHRDKLDPRAIKCVFLGYSSTQKGYKCYNPSTRK 400 Score = 32.3 bits (72), Expect(2) = 5e-11 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEI-FKEDS 218 RK ++ DVTF E +P+F LQGEI EDS Sbjct: 399 RKFYISTDVTFTENKPFFPKSSLQGEISMMEDS 431 >emb|CAN60626.1| hypothetical protein VITISV_018873 [Vitis vinifera] Length = 465 Score = 65.5 bits (158), Expect(2) = 7e-11 Identities = 29/41 (70%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 425 VFVHEHR-KIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 +FVH H K KL+PRA+KCVF+GYS TQKGYKC+DPIS+K Sbjct: 1 MFVHAHTSKQNKLDPRALKCVFLGYSSTQKGYKCYDPISQK 41 Score = 26.9 bits (58), Expect(2) = 7e-11 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEIFKE 224 +K V++ VTFFE PY+ LQGE E Sbjct: 40 QKLYVSLXVTFFEHTPYYS---LQGESMSE 66 >ref|XP_004513812.1| PREDICTED: uncharacterized protein LOC101489272 [Cicer arietinum] Length = 758 Score = 59.7 bits (143), Expect(2) = 8e-11 Identities = 24/46 (52%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 428 TVFVHEHR-KIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKKCCHN 294 T FVH+++ GKLEP+++KC+F+GY P +KG++C+ PISKK H+ Sbjct: 645 TAFVHDNQPNKGKLEPKSLKCIFLGYPPNKKGHRCYYPISKKFYHS 690 Score = 32.3 bits (72), Expect(2) = 8e-11 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 298 TMDVTFFEKQPYFKNIHLQGE 236 +MDVTFF+ QPY+ + QGE Sbjct: 690 SMDVTFFKNQPYYPKVGFQGE 710 >emb|CAN83799.1| hypothetical protein VITISV_033272 [Vitis vinifera] Length = 825 Score = 65.9 bits (159), Expect(2) = 1e-10 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -2 Query: 428 TVFVHEHR-KIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 TVFVH H K KL+P+ +KCVF+GYS TQKGYKC+DPIS+K Sbjct: 529 TVFVHAHAPKRNKLDPKTLKCVFLGYSSTQKGYKCYDPISQK 570 Score = 25.4 bits (54), Expect(2) = 1e-10 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEIFKE 224 +K V +DVT FE PY+ LQG+ E Sbjct: 569 QKLYVNLDVTLFEHTPYYS---LQGKSMSE 595 >emb|CAN73022.1| hypothetical protein VITISV_004050 [Vitis vinifera] Length = 767 Score = 58.9 bits (141), Expect(2) = 1e-10 Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 422 FVHEHRKI-GKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 FVH H + KL+PRAIKCVF+GYS TQKGYKC++P ++K Sbjct: 42 FVHVHNQHRDKLDPRAIKCVFLGYSSTQKGYKCYNPSARK 81 Score = 32.3 bits (72), Expect(2) = 1e-10 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEI-FKEDS 218 RK ++ DVTF E +P+F LQGEI EDS Sbjct: 80 RKFYISADVTFTENKPFFHKSSLQGEISMMEDS 112 >emb|CAN80367.1| hypothetical protein VITISV_014719 [Vitis vinifera] Length = 1573 Score = 50.8 bits (120), Expect(2) = 2e-10 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 395 KLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 KLEPRAIKCV + Y T+ GYKCFDPIS K Sbjct: 48 KLEPRAIKCVLLXYPSTKHGYKCFDPISGK 77 Score = 40.0 bits (92), Expect(2) = 2e-10 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = -3 Query: 310 KNVVTMDVTFFEKQPYFKNIHLQGEIFKEDSF 215 K +TMDV FFEK+PYF LQGE ED F Sbjct: 77 KLFITMDVKFFEKKPYFPITTLQGENMSEDCF 108 >emb|CAN62623.1| hypothetical protein VITISV_001656 [Vitis vinifera] Length = 1394 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 24/44 (54%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -2 Query: 428 TVFVH---EHRKIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 +VFVH +HR KL+PR++KC+F+GYS QKGYKC+ P+++K Sbjct: 743 SVFVHINQQHRS--KLDPRSLKCIFLGYSSNQKGYKCYSPVTRK 784 Score = 33.5 bits (75), Expect(2) = 2e-10 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGE 236 RK +MDVTFFE QPY+ +QGE Sbjct: 783 RKFYNSMDVTFFETQPYYPKNDIQGE 808 >emb|CAN60373.1| hypothetical protein VITISV_034932 [Vitis vinifera] Length = 1264 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 24/44 (54%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -2 Query: 428 TVFVH---EHRKIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 +VFVH +HR KL+PR++KC+F+GYS QKGYKC+ P+++K Sbjct: 607 SVFVHINQQHRS--KLDPRSLKCIFLGYSSNQKGYKCYSPVTRK 648 Score = 33.5 bits (75), Expect(2) = 2e-10 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGE 236 RK +MDVTFFE QPY+ +QGE Sbjct: 647 RKFYNSMDVTFFETQPYYPKNDIQGE 672 >emb|CAN61004.1| hypothetical protein VITISV_015023 [Vitis vinifera] Length = 1010 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 24/44 (54%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -2 Query: 428 TVFVH---EHRKIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 +VFVH +HR KL+PR++KC+F+GYS QKGYKC+ P+++K Sbjct: 301 SVFVHINQQHRS--KLDPRSLKCIFLGYSSNQKGYKCYSPVTRK 342 Score = 33.5 bits (75), Expect(2) = 2e-10 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGE 236 RK +MDVTFFE QPY+ +QGE Sbjct: 341 RKFYNSMDVTFFETQPYYPKNDIQGE 366 >emb|CAN73484.1| hypothetical protein VITISV_029448 [Vitis vinifera] Length = 835 Score = 57.4 bits (137), Expect(2) = 2e-10 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 428 TVFVHEHRKI-GKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 T FVH H + KL+PRAIKC F GYS TQKGYKC++P ++K Sbjct: 265 TAFVHVHXQHRDKLDPRAIKCXFXGYSSTQKGYKCYNPSTRK 306 Score = 33.1 bits (74), Expect(2) = 2e-10 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGEI-FKEDS 218 RK ++ DVTF E +P+F LQGEI EDS Sbjct: 305 RKFYISADVTFIENKPFFHKSSLQGEISMMEDS 337 >emb|CAN73399.1| hypothetical protein VITISV_006541 [Vitis vinifera] Length = 834 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 24/44 (54%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -2 Query: 428 TVFVH---EHRKIGKLEPRAIKCVFIGYSPTQKGYKCFDPISKK 306 +VFVH +HR KL+PR++KC+F+GYS QKGYKC+ P+++K Sbjct: 125 SVFVHINQQHRS--KLDPRSLKCIFLGYSSNQKGYKCYSPVTRK 166 Score = 33.5 bits (75), Expect(2) = 2e-10 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 313 RKNVVTMDVTFFEKQPYFKNIHLQGE 236 RK +MDVTFFE QPY+ +QGE Sbjct: 165 RKFYNSMDVTFFETQPYYPKNDIQGE 190