BLASTX nr result
ID: Akebia23_contig00023393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00023393 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ84632.1| unknown [Medicago truncatula] 86 7e-15 dbj|GAC74885.1| serine-threonine protein kinase FUSED, partial [... 85 1e-14 ref|XP_006363544.1| PREDICTED: serine/threonine-protein phosphat... 84 2e-14 ref|XP_007153880.1| hypothetical protein PHAVU_003G072600g [Phas... 84 2e-14 ref|XP_006417465.1| hypothetical protein EUTSA_v10008290mg [Eutr... 84 2e-14 ref|XP_006392226.1| hypothetical protein EUTSA_v10023605mg [Eutr... 84 2e-14 ref|XP_006843155.1| hypothetical protein AMTR_s00146p00037590 [A... 84 2e-14 ref|XP_006302601.1| hypothetical protein CARUB_v10020707mg [Caps... 84 2e-14 ref|NP_974050.1| serine/threonine-protein phosphatase PP2A-1 cat... 84 2e-14 ref|NP_176192.1| serine/threonine-protein phosphatase PP2A-1 cat... 84 2e-14 ref|NP_172514.1| protein phosphatase 2A-2 [Arabidopsis thaliana]... 84 2e-14 ref|XP_002892571.1| protein phosphatase 2a-2 [Arabidopsis lyrata... 84 2e-14 ref|XP_002268216.2| PREDICTED: serine/threonine-protein phosphat... 84 2e-14 emb|CBI15307.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002267386.1| PREDICTED: serine/threonine-protein phosphat... 84 2e-14 ref|XP_002886653.1| hypothetical protein ARALYDRAFT_475327 [Arab... 84 2e-14 gb|EYU28671.1| hypothetical protein MIMGU_mgv1a0106402mg, partia... 84 3e-14 gb|EYU22454.1| hypothetical protein MIMGU_mgv1a010646mg [Mimulus... 84 3e-14 gb|EXB74728.1| Serine/threonine-protein phosphatase PP2A catalyt... 84 3e-14 gb|EXB29774.1| Serine/threonine-protein phosphatase PP2A catalyt... 84 3e-14 >gb|ACJ84632.1| unknown [Medicago truncatula] Length = 221 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVRFLEW 231 YGFYDECLRKYGNANVWK+FTDLFDYLPLTALIESQ+ L W Sbjct: 124 YGFYDECLRKYGNANVWKFFTDLFDYLPLTALIESQIFCLAW 165 >dbj|GAC74885.1| serine-threonine protein kinase FUSED, partial [Pseudozyma antarctica T-34] Length = 242 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVRFL 237 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALI+ QVR L Sbjct: 183 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIDDQVRLL 222 >ref|XP_006363544.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic subunit-like isoform X1 [Solanum tuberosum] gi|565395842|ref|XP_006363545.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic subunit-like isoform X2 [Solanum tuberosum] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_007153880.1| hypothetical protein PHAVU_003G072600g [Phaseolus vulgaris] gi|561027234|gb|ESW25874.1| hypothetical protein PHAVU_003G072600g [Phaseolus vulgaris] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_006417465.1| hypothetical protein EUTSA_v10008290mg [Eutrema salsugineum] gi|557095236|gb|ESQ35818.1| hypothetical protein EUTSA_v10008290mg [Eutrema salsugineum] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_006392226.1| hypothetical protein EUTSA_v10023605mg [Eutrema salsugineum] gi|557088732|gb|ESQ29512.1| hypothetical protein EUTSA_v10023605mg [Eutrema salsugineum] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_006843155.1| hypothetical protein AMTR_s00146p00037590 [Amborella trichopoda] gi|548845379|gb|ERN04830.1| hypothetical protein AMTR_s00146p00037590 [Amborella trichopoda] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_006302601.1| hypothetical protein CARUB_v10020707mg [Capsella rubella] gi|482571311|gb|EOA35499.1| hypothetical protein CARUB_v10020707mg [Capsella rubella] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|NP_974050.1| serine/threonine-protein phosphatase PP2A-1 catalytic subunit [Arabidopsis thaliana] gi|332195501|gb|AEE33622.1| serine/threonine-protein phosphatase PP2A-1 catalytic subunit [Arabidopsis thaliana] Length = 262 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|NP_176192.1| serine/threonine-protein phosphatase PP2A-1 catalytic subunit [Arabidopsis thaliana] gi|585629|sp|Q07099.1|PP2A1_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-1 catalytic subunit; AltName: Full=Protein phosphatase 2A isoform 1 gi|5080817|gb|AAD39326.1|AC007258_15 Serine/thereonine protein phosphatase PP2A-2 catalytic subunit [Arabidopsis thaliana] gi|166821|gb|AAA32847.1| protein phosphatase [Arabidopsis thaliana] gi|17380972|gb|AAL36298.1| putative serine/threonine protein phosphatase type 2A [Arabidopsis thaliana] gi|20465467|gb|AAM20193.1| putative serine/threonine protein phosphatase type 2A [Arabidopsis thaliana] gi|332195502|gb|AEE33623.1| serine/threonine-protein phosphatase PP2A-1 catalytic subunit [Arabidopsis thaliana] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|NP_172514.1| protein phosphatase 2A-2 [Arabidopsis thaliana] gi|565492810|ref|XP_006304044.1| hypothetical protein CARUB_v10009843mg [Capsella rubella] gi|585628|sp|Q07098.1|PP2A2_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-2 catalytic subunit; AltName: Full=Protein phosphatase 2A isoform 2 gi|5091535|gb|AAD39564.1|AC007067_4 T10O24.4 [Arabidopsis thaliana] gi|166823|gb|AAA32848.1| protein phosphatase [Arabidopsis thaliana] gi|16648955|gb|AAL24329.1| similar to protein phosphatase type 2A [Arabidopsis thaliana] gi|20259838|gb|AAM13266.1| similar to protein phosphatase type 2A [Arabidopsis thaliana] gi|332190458|gb|AEE28579.1| protein phosphatase 2A-2 [Arabidopsis thaliana] gi|482572755|gb|EOA36942.1| hypothetical protein CARUB_v10009843mg [Capsella rubella] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_002892571.1| protein phosphatase 2a-2 [Arabidopsis lyrata subsp. lyrata] gi|297338413|gb|EFH68830.1| protein phosphatase 2a-2 [Arabidopsis lyrata subsp. lyrata] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_002268216.2| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Vitis vinifera] gi|296086472|emb|CBI32061.3| unnamed protein product [Vitis vinifera] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >emb|CBI15307.3| unnamed protein product [Vitis vinifera] Length = 268 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 86 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 122 >ref|XP_002267386.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Vitis vinifera] gi|147784485|emb|CAN74947.1| hypothetical protein VITISV_000262 [Vitis vinifera] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >ref|XP_002886653.1| hypothetical protein ARALYDRAFT_475327 [Arabidopsis lyrata subsp. lyrata] gi|21593150|gb|AAM65099.1| serine/threonine protein phosphatase type 2A, putative [Arabidopsis thaliana] gi|297332494|gb|EFH62912.1| hypothetical protein ARALYDRAFT_475327 [Arabidopsis lyrata subsp. lyrata] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 160 >gb|EYU28671.1| hypothetical protein MIMGU_mgv1a0106402mg, partial [Mimulus guttatus] Length = 183 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQ+ Sbjct: 1 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQI 37 >gb|EYU22454.1| hypothetical protein MIMGU_mgv1a010646mg [Mimulus guttatus] Length = 306 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQ+ Sbjct: 124 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQI 160 >gb|EXB74728.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Morus notabilis] Length = 323 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQ+ Sbjct: 141 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQI 177 >gb|EXB29774.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Morus notabilis] Length = 307 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 356 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQV 246 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQ+ Sbjct: 125 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQI 161