BLASTX nr result
ID: Akebia23_contig00022789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00022789 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003302578.1| hypothetical protein PTT_14453 [Pyrenophora ... 65 1e-13 gb|EUC45741.1| hypothetical protein COCMIDRAFT_26100 [Bipolaris ... 63 8e-13 ref|XP_001933276.1| peptidyl-prolyl cis-trans isomerase B precur... 77 2e-12 ref|XP_001794502.1| hypothetical protein SNOG_03959 [Phaeosphaer... 75 7e-12 gb|ENI06010.1| hypothetical protein COCC4DRAFT_80920 [Bipolaris ... 59 8e-12 ref|XP_003841999.1| hypothetical protein LEMA_P077590.1 [Leptosp... 55 1e-11 ref|XP_003851185.1| hypothetical protein MYCGRDRAFT_44978 [Zymos... 74 3e-11 ref|XP_001911375.1| hypothetical protein [Podospora anserina S m... 72 6e-11 ref|XP_001225362.1| hypothetical protein CHGG_07706 [Chaetomium ... 72 1e-10 gb|EME39331.1| hypothetical protein DOTSEDRAFT_75145 [Dothistrom... 72 1e-10 gb|EJT76967.1| peptidyl-prolyl cis-trans isomerase B [Gaeumannom... 72 1e-10 gb|EHY51808.1| peptidyl-prolyl cis-trans isomerase B [Exophiala ... 72 1e-10 gb|ETN38545.1| peptidyl-prolyl cis-trans isomerase B [Cyphelloph... 71 1e-10 gb|EFY91535.1| peptidyl-prolyl cis-trans isomerase B precursor [... 71 1e-10 gb|EMC91221.1| hypothetical protein BAUCODRAFT_127134 [Baudoinia... 70 4e-10 gb|ETI28757.1| peptidyl-prolyl cis-trans isomerase B [Cladophial... 69 5e-10 gb|EHK27517.1| hypothetical protein TRIVIDRAFT_110996 [Trichoder... 69 5e-10 ref|XP_006969110.1| peptidyl-prolyl isomerase [Trichoderma reese... 69 5e-10 gb|EMD61933.1| hypothetical protein COCSADRAFT_38732 [Bipolaris ... 69 7e-10 ref|XP_003661719.1| hypothetical protein MYCTH_2301478 [Myceliop... 69 7e-10 >ref|XP_003302578.1| hypothetical protein PTT_14453 [Pyrenophora teres f. teres 0-1] gi|311321984|gb|EFQ89343.1| hypothetical protein PTT_14453 [Pyrenophora teres f. teres 0-1] Length = 301 Score = 64.7 bits (156), Expect(2) = 1e-13 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIH 142 YD+VEKIENV KGAGDKP+K VKIAKSGELEVP E ++ Sbjct: 168 YDIVEKIENVPKGAGDKPNKPVKIAKSGELEVPAEDLY 205 Score = 37.4 bits (85), Expect(2) = 1e-13 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -1 Query: 77 EDLYGEAEPATQGDNLDVTSPSI 9 EDLYG AEPA GDNLDVT+ ++ Sbjct: 202 EDLYGVAEPAIPGDNLDVTATTV 224 >gb|EUC45741.1| hypothetical protein COCMIDRAFT_26100 [Bipolaris oryzae ATCC 44560] Length = 283 Score = 62.8 bits (151), Expect(2) = 8e-13 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIH 142 YD+VEKIENV+K GDKP KTVKIAKSGELEVP E ++ Sbjct: 161 YDIVEKIENVEKSPGDKPVKTVKIAKSGELEVPAEDLY 198 Score = 36.2 bits (82), Expect(2) = 8e-13 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 77 EDLYGEAEPATQGDNLDVTSPSI 9 EDLYG+A+PA DNLDVTS + Sbjct: 195 EDLYGDAQPADPSDNLDVTSSKV 217 >ref|XP_001933276.1| peptidyl-prolyl cis-trans isomerase B precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978840|gb|EDU45466.1| peptidyl-prolyl cis-trans isomerase B precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 208 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIENV KGAGDKPSKTVKIAKSGELEVP EGIH EL Sbjct: 168 YDIVEKIENVPKGAGDKPSKTVKIAKSGELEVPAEGIHAEL 208 >ref|XP_001794502.1| hypothetical protein SNOG_03959 [Phaeosphaeria nodorum SN15] gi|160706095|gb|EAT89164.2| hypothetical protein SNOG_03959 [Phaeosphaeria nodorum SN15] Length = 210 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YDVV+KIENV KG+GDKP KTVKIAKSGELEVPEEGIH EL Sbjct: 170 YDVVDKIENVPKGSGDKPVKTVKIAKSGELEVPEEGIHAEL 210 >gb|ENI06010.1| hypothetical protein COCC4DRAFT_80920 [Bipolaris maydis ATCC 48331] Length = 290 Score = 58.9 bits (141), Expect(2) = 8e-12 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIH 142 YDVVEKIENV K GD+P K VKIAKSGELEVP E ++ Sbjct: 168 YDVVEKIENVQKAPGDRPVKPVKIAKSGELEVPAEDLY 205 Score = 36.6 bits (83), Expect(2) = 8e-12 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 77 EDLYGEAEPATQGDNLDVTS 18 EDLYG+AEPA DNLDVTS Sbjct: 202 EDLYGDAEPADPSDNLDVTS 221 >ref|XP_003841999.1| hypothetical protein LEMA_P077590.1 [Leptosphaeria maculans JN3] gi|312218575|emb|CBX98520.1| hypothetical protein LEMA_P077590.1 [Leptosphaeria maculans JN3] Length = 165 Score = 55.1 bits (131), Expect(2) = 1e-11 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIH 142 Y+VVE IEN+ KG+GDKP K V IAKSGELEVP E ++ Sbjct: 37 YNVVEAIENLPKGSGDKPLKPVTIAKSGELEVPPEDLY 74 Score = 39.7 bits (91), Expect(2) = 1e-11 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 77 EDLYGEAEPATQGDNLDVTSPS 12 EDLYG AEPAT GDNLDVT+ S Sbjct: 71 EDLYGVAEPATPGDNLDVTAAS 92 >ref|XP_003851185.1| hypothetical protein MYCGRDRAFT_44978 [Zymoseptoria tritici IPO323] gi|339471064|gb|EGP86161.1| hypothetical protein MYCGRDRAFT_44978 [Zymoseptoria tritici IPO323] Length = 195 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIENV KG+GDKPSKTVKI KSGELEVPEEGI EL Sbjct: 155 YDIVEKIENVPKGSGDKPSKTVKIKKSGELEVPEEGIRAEL 195 >ref|XP_001911375.1| hypothetical protein [Podospora anserina S mat+] gi|170946399|emb|CAP73200.1| unnamed protein product [Podospora anserina S mat+] Length = 208 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIENV GDKP KTVKIAKSGELEVPEEGIHVEL Sbjct: 168 YDIVEKIENVKTQPGDKPEKTVKIAKSGELEVPEEGIHVEL 208 >ref|XP_001225362.1| hypothetical protein CHGG_07706 [Chaetomium globosum CBS 148.51] gi|88178985|gb|EAQ86453.1| hypothetical protein CHGG_07706 [Chaetomium globosum CBS 148.51] Length = 207 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YDVVEKIENVD GDKP +TVKIAKSGELEVP EGIHVEL Sbjct: 167 YDVVEKIENVDTAPGDKPVQTVKIAKSGELEVPPEGIHVEL 207 >gb|EME39331.1| hypothetical protein DOTSEDRAFT_75145 [Dothistroma septosporum NZE10] Length = 208 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/41 (85%), Positives = 35/41 (85%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YDVVEKIEN KGAGDKP TVKIAKSGELEVPEEGI EL Sbjct: 168 YDVVEKIENTPKGAGDKPKATVKIAKSGELEVPEEGIRAEL 208 >gb|EJT76967.1| peptidyl-prolyl cis-trans isomerase B [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 208 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 Y++VE+IENVDK GDKP KTV+IAKSGELEVPEEGIH+EL Sbjct: 168 YNIVEQIENVDKEPGDKPKKTVRIAKSGELEVPEEGIHMEL 208 >gb|EHY51808.1| peptidyl-prolyl cis-trans isomerase B [Exophiala dermatitidis NIH/UT8656] Length = 208 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YDVVEKIENV KG+GDKP+K VKI KSGELEVP EGIH EL Sbjct: 168 YDVVEKIENVPKGSGDKPAKPVKIVKSGELEVPPEGIHAEL 208 >gb|ETN38545.1| peptidyl-prolyl cis-trans isomerase B [Cyphellophora europaea CBS 101466] Length = 208 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YDVV+KIEN +KGAGDKP +KI KSGELEVPEEGIHVEL Sbjct: 168 YDVVDKIENCEKGAGDKPKVAIKIKKSGELEVPEEGIHVEL 208 >gb|EFY91535.1| peptidyl-prolyl cis-trans isomerase B precursor [Metarhizium acridum CQMa 102] Length = 298 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIEN++ AGDKP +TVKIAKSGELEVP EGIHVEL Sbjct: 258 YDIVEKIENIETSAGDKPVQTVKIAKSGELEVPPEGIHVEL 298 >gb|EMC91221.1| hypothetical protein BAUCODRAFT_127134 [Baudoinia compniacensis UAMH 10762] Length = 208 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YDVV+KIENV KGAGDKP++TVKI KSGELE+PEEGI EL Sbjct: 168 YDVVDKIENVAKGAGDKPAQTVKIKKSGELEMPEEGIRAEL 208 >gb|ETI28757.1| peptidyl-prolyl cis-trans isomerase B [Cladophialophora carrionii CBS 160.54] Length = 208 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YDVVE+IENV KG+GD+P+K VKIAKSGELEVP EGIH EL Sbjct: 168 YDVVEQIENVPKGSGDRPAKPVKIAKSGELEVPPEGIHNEL 208 >gb|EHK27517.1| hypothetical protein TRIVIDRAFT_110996 [Trichoderma virens Gv29-8] Length = 207 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIEN AGD+P KTVKIAKSGELEVP EGIHVEL Sbjct: 167 YDIVEKIENAPTAAGDRPVKTVKIAKSGELEVPPEGIHVEL 207 >ref|XP_006969110.1| peptidyl-prolyl isomerase [Trichoderma reesei QM6a] gi|340514676|gb|EGR44936.1| peptidyl-prolyl isomerase [Trichoderma reesei QM6a] gi|572274379|gb|ETR97909.1| hypothetical protein M419DRAFT_103941 [Trichoderma reesei RUT C-30] Length = 207 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIENV G GD+P K VKIAKSGELEVP EGIHVEL Sbjct: 167 YDIVEKIENVQTGPGDRPVKPVKIAKSGELEVPPEGIHVEL 207 >gb|EMD61933.1| hypothetical protein COCSADRAFT_38732 [Bipolaris sorokiniana ND90Pr] Length = 208 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIENV K GDKP KTVKIAKSGEL+VP EGIH EL Sbjct: 168 YDIVEKIENVQKAPGDKPVKTVKIAKSGELKVPAEGIHEEL 208 >ref|XP_003661719.1| hypothetical protein MYCTH_2301478 [Myceliophthora thermophila ATCC 42464] gi|347008987|gb|AEO56474.1| hypothetical protein MYCTH_2301478 [Myceliophthora thermophila ATCC 42464] Length = 207 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 255 YDVVEKIENVDKGAGDKPSKTVKIAKSGELEVPEEGIHVEL 133 YD+VEKIENV+ GDKP KTVKI KSGELEVP EGIHVEL Sbjct: 167 YDIVEKIENVETKPGDKPVKTVKIVKSGELEVPPEGIHVEL 207