BLASTX nr result
ID: Akebia23_contig00022740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00022740 (1096 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004304362.1| PREDICTED: probable protein phosphatase 2C 6... 59 4e-06 >ref|XP_004304362.1| PREDICTED: probable protein phosphatase 2C 68-like [Fragaria vesca subsp. vesca] Length = 383 Score = 58.9 bits (141), Expect = 4e-06 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -1 Query: 121 FPTFPSGRTLGRPVLSTEPSIYTRVLQPLDRFFIFASDGL 2 FP F LGRPVLS EPS+ TRVLQP DRF IFASDGL Sbjct: 245 FPRFQLPEPLGRPVLSAEPSVCTRVLQPEDRFIIFASDGL 284