BLASTX nr result
ID: Akebia23_contig00022668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00022668 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476772.1| PREDICTED: putative exosome complex componen... 60 3e-07 ref|XP_006439811.1| hypothetical protein CICLE_v10021986mg [Citr... 60 3e-07 ref|XP_002282635.1| PREDICTED: putative exosome complex componen... 60 3e-07 ref|XP_006468006.1| PREDICTED: adenosine deaminase-like protein-... 59 5e-07 ref|XP_006449060.1| hypothetical protein CICLE_v10015698mg [Citr... 59 5e-07 ref|XP_006449059.1| hypothetical protein CICLE_v10015698mg [Citr... 59 5e-07 ref|XP_004138110.1| PREDICTED: putative exosome complex componen... 58 2e-06 ref|XP_007026025.1| Adenosine/AMP deaminase family protein isofo... 58 2e-06 ref|XP_007026024.1| Adenosine/AMP deaminase family protein isofo... 58 2e-06 >ref|XP_006476772.1| PREDICTED: putative exosome complex component rrp40-like isoform X1 [Citrus sinensis] gi|568845839|ref|XP_006476773.1| PREDICTED: putative exosome complex component rrp40-like isoform X2 [Citrus sinensis] Length = 238 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -2 Query: 387 KLYVNADSPSTVILVTNAITTSEPLSRVQQRIMVDKLMQRLQ 262 +++VNA+SPSTV+LV+NAI SE LS VQQ+IMVDKL+QR++ Sbjct: 197 RVWVNAESPSTVVLVSNAIMNSESLSAVQQKIMVDKLLQRIK 238 >ref|XP_006439811.1| hypothetical protein CICLE_v10021986mg [Citrus clementina] gi|567894648|ref|XP_006439812.1| hypothetical protein CICLE_v10021986mg [Citrus clementina] gi|557542073|gb|ESR53051.1| hypothetical protein CICLE_v10021986mg [Citrus clementina] gi|557542074|gb|ESR53052.1| hypothetical protein CICLE_v10021986mg [Citrus clementina] Length = 238 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -2 Query: 387 KLYVNADSPSTVILVTNAITTSEPLSRVQQRIMVDKLMQRLQ 262 +++VNA+SPSTV+LV+NAI SE LS VQQ+IMVDKL+QR++ Sbjct: 197 RVWVNAESPSTVVLVSNAIMNSESLSAVQQKIMVDKLLQRIK 238 >ref|XP_002282635.1| PREDICTED: putative exosome complex component rrp40 [Vitis vinifera] gi|297733775|emb|CBI15022.3| unnamed protein product [Vitis vinifera] Length = 237 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 387 KLYVNADSPSTVILVTNAITTSEPLSRVQQRIMVDKLMQRLQ 262 +++VNA SPSTVILV NAI SE LS VQQ+IMVDKL+QR+Q Sbjct: 196 RVWVNASSPSTVILVANAIMNSESLSVVQQKIMVDKLLQRIQ 237 >ref|XP_006468006.1| PREDICTED: adenosine deaminase-like protein-like isoform X1 [Citrus sinensis] gi|568827310|ref|XP_006468007.1| PREDICTED: adenosine deaminase-like protein-like isoform X2 [Citrus sinensis] Length = 363 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 98 DFKAMLDFLPQRIGHAICFEVEEWRKLKSSKI 3 + ++MLDFLPQRIGHA CFE EEWRKLKSSKI Sbjct: 233 EIQSMLDFLPQRIGHACCFEEEEWRKLKSSKI 264 >ref|XP_006449060.1| hypothetical protein CICLE_v10015698mg [Citrus clementina] gi|557551671|gb|ESR62300.1| hypothetical protein CICLE_v10015698mg [Citrus clementina] Length = 363 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 98 DFKAMLDFLPQRIGHAICFEVEEWRKLKSSKI 3 + ++MLDFLPQRIGHA CFE EEWRKLKSSKI Sbjct: 233 EIQSMLDFLPQRIGHACCFEEEEWRKLKSSKI 264 >ref|XP_006449059.1| hypothetical protein CICLE_v10015698mg [Citrus clementina] gi|557551670|gb|ESR62299.1| hypothetical protein CICLE_v10015698mg [Citrus clementina] Length = 269 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 98 DFKAMLDFLPQRIGHAICFEVEEWRKLKSSKI 3 + ++MLDFLPQRIGHA CFE EEWRKLKSSKI Sbjct: 233 EIQSMLDFLPQRIGHACCFEEEEWRKLKSSKI 264 >ref|XP_004138110.1| PREDICTED: putative exosome complex component rrp40-like [Cucumis sativus] gi|449477413|ref|XP_004155016.1| PREDICTED: putative exosome complex component rrp40-like [Cucumis sativus] Length = 243 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -2 Query: 387 KLYVNADSPSTVILVTNAITTSEPLSRVQQRIMVDKLMQRLQ 262 +++VNADSPST+I+V+NAI SE LS VQQRIMVDKL+ L+ Sbjct: 199 RVWVNADSPSTIIVVSNAILNSETLSGVQQRIMVDKLLANLK 240 >ref|XP_007026025.1| Adenosine/AMP deaminase family protein isoform 2, partial [Theobroma cacao] gi|508781391|gb|EOY28647.1| Adenosine/AMP deaminase family protein isoform 2, partial [Theobroma cacao] Length = 312 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 98 DFKAMLDFLPQRIGHAICFEVEEWRKLKSSKI 3 + KAMLDFLPQRIGHA CFE E WRKLKS KI Sbjct: 182 EIKAMLDFLPQRIGHACCFEEENWRKLKSLKI 213 >ref|XP_007026024.1| Adenosine/AMP deaminase family protein isoform 1 [Theobroma cacao] gi|508781390|gb|EOY28646.1| Adenosine/AMP deaminase family protein isoform 1 [Theobroma cacao] Length = 358 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 98 DFKAMLDFLPQRIGHAICFEVEEWRKLKSSKI 3 + KAMLDFLPQRIGHA CFE E WRKLKS KI Sbjct: 228 EIKAMLDFLPQRIGHACCFEEENWRKLKSLKI 259