BLASTX nr result
ID: Akebia23_contig00022270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00022270 (1034 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009026654.1| ATP synthase CF0 subunit IV (chloroplast) [J... 83 2e-13 ref|YP_009026728.1| ATP synthase CF0 subunit IV (chloroplast) [J... 83 2e-13 gb|AHI87515.1| ATP synthase CF0 A chain subunit IV (chloroplast)... 83 2e-13 ref|NP_042364.1| ATP synthase CF0 A subunit [Pinus thunbergii] g... 83 2e-13 ref|YP_008082114.1| ATP synthase CF0 A subunit (chloroplast) [Cu... 83 2e-13 ref|YP_008965191.1| ATP synthase CF0 A chain (chloroplast) [Calo... 83 2e-13 gb|AFU97050.1| AtpI, partial (chloroplast) [Vismia ferruginea] 83 2e-13 gb|AET48450.1| ATP synthase CF0 A subunit (chloroplast) [Pinus g... 83 2e-13 gb|AET48307.1| ATP synthase CF0 A subunit (chloroplast) [Pinus h... 83 2e-13 gb|AET47229.1| ATP synthase CF0 A subunit (chloroplast) [Pinus m... 83 2e-13 gb|AET47086.1| ATP synthase CF0 A subunit, partial (chloroplast)... 83 2e-13 gb|AET45795.1| ATP synthase CF0 A subunit (chloroplast) [Pinus r... 83 2e-13 gb|AET45724.1| ATP synthase CF0 A subunit (chloroplast) [Pinus s... 83 2e-13 gb|AET45437.1| ATP synthase CF0 A subunit, partial (chloroplast)... 83 2e-13 gb|AET44940.1| ATP synthase CF0 A subunit (chloroplast) [Pinus a... 83 2e-13 gb|AET44797.1| ATP synthase CF0 A subunit (chloroplast) [Pinus b... 83 2e-13 ref|YP_004891487.1| ATP synthase CF0 A chain (chloroplast) [Taiw... 83 2e-13 gb|ACP52504.1| ATP synthase CF0 A subunit [Pinus pinaster] 83 2e-13 gb|ACP51203.1| ATP synthase CF0 A subunit [Pinus thunbergii] 83 2e-13 gb|ACP51075.1| ATP synthase CF0 A subunit [Pinus strobus] 83 2e-13 >ref|YP_009026654.1| ATP synthase CF0 subunit IV (chloroplast) [Juniperus monosperma] gi|576597896|gb|AHH30149.1| ATP synthase CF0 subunit IV (chloroplast) [Juniperus monosperma] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >ref|YP_009026728.1| ATP synthase CF0 subunit IV (chloroplast) [Juniperus scopulorum] gi|619275681|ref|YP_009026818.1| ATP synthase CF0 subunit IV (chloroplast) [Juniperus virginiana] gi|576597810|gb|AHH30064.1| ATP synthase CF0 subunit IV (chloroplast) [Juniperus bermudiana] gi|576597974|gb|AHH30226.1| ATP synthase CF0 subunit IV (chloroplast) [Juniperus scopulorum] gi|576598066|gb|AHH30317.1| ATP synthase CF0 subunit IV (chloroplast) [Juniperus virginiana] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AHI87515.1| ATP synthase CF0 A chain subunit IV (chloroplast) [Chionographis japonica] Length = 247 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 158 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 208 >ref|NP_042364.1| ATP synthase CF0 A subunit [Pinus thunbergii] gi|1168600|sp|P41604.1|ATPI_PINTH RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|1262604|dbj|BAA04322.1| H+-ATPase a subunit [Pinus thunbergii] gi|357000225|gb|AET48092.1| ATP synthase CF0 A subunit (chloroplast) [Pinus hwangshanensis] gi|357000661|gb|AET48522.1| ATP synthase CF0 A subunit (chloroplast) [Pinus fragilissima] gi|357001321|gb|AET49173.1| ATP synthase CF0 A subunit (chloroplast) [Pinus densata] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >ref|YP_008082114.1| ATP synthase CF0 A subunit (chloroplast) [Cunninghamia lanceolata] gi|490344931|gb|AGL10960.1| ATP synthase CF0 A subunit (chloroplast) [Cunninghamia lanceolata] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >ref|YP_008965191.1| ATP synthase CF0 A chain (chloroplast) [Calocedrus formosana] gi|482840949|dbj|BAN16940.1| ATP synthase CF0 A chain (chloroplast) [Calocedrus formosana] gi|563317776|dbj|BAO19874.1| ATP synthase CF0 A chain (chloroplast) [Calocedrus formosana] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AFU97050.1| AtpI, partial (chloroplast) [Vismia ferruginea] Length = 256 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 L Y GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+VG+LVSL+ Sbjct: 167 LSYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVGVLVSLV 217 >gb|AET48450.1| ATP synthase CF0 A subunit (chloroplast) [Pinus glabra] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AET48307.1| ATP synthase CF0 A subunit (chloroplast) [Pinus halepensis] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AET47229.1| ATP synthase CF0 A subunit (chloroplast) [Pinus morrisonicola] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AET47086.1| ATP synthase CF0 A subunit, partial (chloroplast) [Pinus muricata] Length = 221 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 132 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 182 >gb|AET45795.1| ATP synthase CF0 A subunit (chloroplast) [Pinus roxburghii] gi|356998115|gb|AET46011.1| ATP synthase CF0 A subunit (chloroplast) [Pinus radiata] gi|356998694|gb|AET46582.1| ATP synthase CF0 A subunit (chloroplast) [Pinus pinea] gi|356999422|gb|AET47300.1| ATP synthase CF0 A subunit (chloroplast) [Pinus montezumae] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AET45724.1| ATP synthase CF0 A subunit (chloroplast) [Pinus sabiniana] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AET45437.1| ATP synthase CF0 A subunit, partial (chloroplast) [Pinus taiwanensis] Length = 242 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 153 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 203 >gb|AET44940.1| ATP synthase CF0 A subunit (chloroplast) [Pinus amamiana] gi|356998334|gb|AET46227.1| ATP synthase CF0 A subunit (chloroplast) [Pinus pumila] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|AET44797.1| ATP synthase CF0 A subunit (chloroplast) [Pinus brutia] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >ref|YP_004891487.1| ATP synthase CF0 A chain (chloroplast) [Taiwania cryptomerioides] gi|512721789|ref|YP_008082404.1| ATP synthase CF0 A chain (chloroplast) [Taiwania flousiana] gi|347977390|dbj|BAK86821.1| ATP synthase CF0 A chain (chloroplast) [Taiwania cryptomerioides] gi|490345262|gb|AGL11250.1| ATP synthase CF0 A chain (chloroplast) [Taiwania flousiana] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|ACP52504.1| ATP synthase CF0 A subunit [Pinus pinaster] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|ACP51203.1| ATP synthase CF0 A subunit [Pinus thunbergii] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209 >gb|ACP51075.1| ATP synthase CF0 A subunit [Pinus strobus] Length = 248 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 394 LGYLGKYIQLTTILLPTNILEDFPKPLLLSFRLFGNILADELIVGILVSLI 546 LGY GKYIQ T ILLP NILEDF KPL LSFRLFGNILADEL+V +LVSL+ Sbjct: 159 LGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVAVLVSLV 209